spacer

EBI Dbfetch

ID   FM865852; SV 1; linear; genomic DNA; STD; HUM; 1365 BP.
XX
AC   FM865852;
XX
DT   05-NOV-2008 (Rel. 97, Created)
DT   05-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*05new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1365
RA   Dormoy A.;
RT   ;
RL   Submitted (03-NOV-2008) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Leisenbach R., Schell A.;
RT   "The new Cw*05 allele is identical to the current HLA-Cw*050101 allele
RT   except a substitution at nucleotide position 512 leading to the change of
RT   the amino acid 147 (Trp(TGG) -> Leu (TTG))";
RL   Unpublished.
XX
DR   MD5; 9eed6b94de6b63bcdb8ef080fc238a8a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1365
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /PCR_primers="fwd_name: Intron1 Cw(A10), fwd_seq:
FT                   cctgggcctgtgagtgcga, rev_name: P3' Intron 4C, rev_seq:
FT                   ctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<121..390,637..912,1001..>1276)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B6VPZ4"
FT                   /db_xref="IMGT/HLA:C*05:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6VPZ4"
FT                   /protein_id="CAR97780.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKLEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            121..390
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /number=2
FT   intron          391..636
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /number=2
FT   exon            637..912
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /number=3
FT   intron          913..1000
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /number=3
FT   exon            1001..1276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*05new"
FT                   /number=4
XX
SQ   Sequence 1365 BP; 265 A; 414 C; 492 G; 194 T; 0 other;
     ggttgggagg gaaacggcct ctgcggagag gagcgagggg cccgcccggc gagggcgcag        60
     gacccgggga gccgcgcagg gaggagggtc gggcgggtct cagcccctcc tcgcccccag       120
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc       180
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       240
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       300
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       360
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       420
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccg gtctgagatc       480
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       540
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       600
     ctcgggggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagaggatgt       660
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       720
     acggcaagga ttacatcgcc ctgaatgagg acctgcgctc ctggaccgcc gcggacaagg       780
     cggctcagat cacccagcgc aagttggagg cggcccgtga ggcggagcag cggagagcct       840
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aagaagacgc       900
     tgcagcgcgc gggtaccagg ggcagtgggg agccttgggc actgttggag tgtcgcaaga       960
     gagatacaaa gtgtctgaat tttctgactc ttcccgtcag aacacccaaa gacacacgtg      1020
     acccaccatc ccgtctctga ccatgaggcc accctgaggt gctgggccct gggcttctac      1080
     cctgcggaga tcacactgac ctggcagcgg gatggcgagg accaaactca ggacaccgag      1140
     cttgtggaga ccaggccagc aggagatgga accttccaga agtgggcagc tgtggtggtg      1200
     ccttctggag aagagcagag atacacgtgc catgtgcagc acgaggggct gccagagccc      1260
     ctcaccctga gatggggtaa ggagggggat gaggggtcat gtgtcttctc agggaaagca      1320
     gaagtcctgg agcccttcag ccgggtcagg gctgaggctt ggggg                      1365
//


spacer
spacer