spacer

EBI Dbfetch

ID   FM212659; SV 1; linear; genomic DNA; STD; HUM; 818 BP.
XX
AC   FM212659;
XX
DT   08-OCT-2008 (Rel. 97, Created)
DT   08-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*0120
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-818
RA   Witter K.;
RT   ;
RL   Submitted (30-SEP-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Klaus W.;
RT   "Confirmation of HLA-DRB1*0120";
RL   Unpublished.
XX
DR   MD5; 61dc41d57e17d93bd361bf24751ebd1c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..818
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<116..385,518..>799)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0120"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B6ETR7"
FT                   /db_xref="IMGT/HLA:DRB1*01:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B6ETR7"
FT                   /protein_id="CAR82093.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            116..385
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0120"
FT                   /number=2
FT   intron          join(386..>425,<504..517)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0120"
FT                   /number=2
FT   gap             426..503
FT                   /estimated_length=78
FT   exon            518..799
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0120"
FT                   /number=3
XX
SQ   Sequence 818 BP; 145 A; 192 C; 248 G; 155 T; 78 other;
     gccggttaag gttcccagtg cccgcaccct gcccagggag ccccggatgg tggcgtcgct        60
     gtcagtgtct tctcaggagg ctgcccgtgt gaccggatcc ttcgtgtccc cacagcacgt       120
     ttcttgtggc agcttaagtt tgaatgtcat ttcttcaatg ggacggagcg ggtgcggttg       180
     ctggaaagat gcatctataa ccaagaggag tccgtgcgct tcgacagcga cgtgggggag       240
     taccgggcgg tgacggagct ggggcggcct gatgccgagt actggaacag ccagaaggac       300
     ctcctggagc agaggcgggc cgcggtggac acctactgca gacacaacta cggggttgtg       360
     gagagcttca cagtgcagcg gcgaggtgag cgcggcgcgg ggcggggcct gagtccctgt       420
     aagcgnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnttgtttt ctcctagttg agcctaaggt gactgtgtat       540
     ccttcaaaga cccagcccct gcagcaccac aacctcctgg tctgctctgt gagtggtttc       600
     tatccaggca gcattgaagt caggtggttc cggaacggcc aggaagagaa ggctggggtg       660
     gtgtccacag gcctgatcca gaatggagat tggaccttcc agaccctggt gatgctggaa       720
     acagttcctc ggagtggaga ggtttacacc tgccaagtgg agcacccaag tgtgacgagc       780
     cctctcacag tggaatggag tgagcagctt tctgactt                               818
//


spacer
spacer