Dbfetch

ID   FM212459; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FM212459;
XX
DT   29-SEP-2008 (Rel. 97, Created)
DT   29-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Human partial HLA-CW gene for MHC class I antigen, HLA-CW*04 allele, exons
DE   2 and 3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Kipper K.;
RT   ;
RL   Submitted (24-SEP-2008) to the INSDC.
RL   Kipper K., Immunogenetics, Center for Human Genetics, Lochhamer Str. 29,
RL   82152 Martinsried, GERMANY.
XX
RN   [2]
RA   Kipper K., Woelpl A., Hirv K., Herbst M.;
RT   "Identification of a novel HLA-Cw*04 variant in one unrelated caucasian
RT   bone marrow donor";
RL   Unpublished.
XX
DR   MD5; 7fa81e548fdb4d847342f919dd82369c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /collected_by="Stefan Morsch Fondation"
FT                   /collection_date="25-Mar-2008"
FT                   /sex="male"
FT                   /haplotype="A*11 B*35 Cw*04"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-CW"
FT                   /allele="HLA-CW*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*04:37"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B6ETP9"
FT                   /protein_id="CAR81649.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMCGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-CW"
FT                   /allele="HLA-CW*04"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-CW"
FT                   /allele="HLA-CW*04"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 166 C; 200 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//