spacer

EBI Dbfetch

ID   FM211161; SV 1; linear; genomic DNA; STD; HUM; 1542 BP.
XX
AC   FM211161;
XX
DT   18-SEP-2008 (Rel. 97, Created)
DT   24-JUL-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*18new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1542
RA   Witter K.;
RT   ;
RL   Submitted (07-AUG-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01268.x.
RX   PUBMED; 19497044.
RA   Witter K., Conrad H., Bernhard H., Albert T., Kauke T.;
RT   "HLA-B*1832, a novel B allele was found through high-resolution HLA typing
RT   of a Spanish blood donor";
RL   Tissue Antigens 74(2):170-172(2009).
XX
DR   MD5; 5fae59e69a7682ef2083bb0f2af8366f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1542
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<71..340,531..806,1227..>1502)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B5U8C8"
FT                   /db_xref="IMGT/HLA:B*18:32"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5U8C8"
FT                   /protein_id="CAR66475.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQSKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            71..340
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=2
FT   intron          341..530
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=2
FT   gap             416..515
FT                   /estimated_length=unknown
FT   exon            531..806
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=3
FT   intron          807..1226
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=3
FT   gap             895..994
FT                   /estimated_length=unknown
FT   exon            1227..1502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=4
XX
SQ   Sequence 1542 BP; 270 A; 424 C; 438 G; 210 T; 200 other;
     cgggggcgca ggacccgggg agccgcgccg ggaggagggt cgggcgggtc tcagcccctc        60
     cttgccccag gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc       120
     ggggagcccc gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac       180
     agcgacgccg cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg       240
     gagtattggg accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc       300
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       360
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnncgggg ccggggccag ggtctcacac       540
     cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc gcgggcatga       600
     ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga gctcctggac       660
     cgcggcggac accgcggctc agatcaccca gagcaagtgg gaggcggccc gtgtggcgga       720
     gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagac acctggagaa       780
     cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt ccccatctcc       840
     tataggtcgc cggggatggc ctcccacgag aagaggagga aaatggggat cagcnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnagtcac tttacctcca ctcagatcag      1020
     gagcagaagt ctctgttccc cgctcagaga ctcgaacttt ccaatgaata gattatccca      1080
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg      1140
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc      1200
     ctgaattttc tgactcttcc catcagaccc cccaaagaca catgtgaccc accaccccat      1260
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1320
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag      1380
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      1440
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1500
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aa                         1542
//


spacer
spacer