spacer

EBI Dbfetch

ID   FM211033; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FM211033;
XX
DT   22-SEP-2008 (Rel. 97, Created)
DT   22-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, exon 2,
DE   isolate SHNA4805AN
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (16-SEP-2008) to the INSDC.
RL   McWhinnie A.J.M., Anthony Nolan Research Institute, Royal Free Hospital,
RL   Fleet Road, Hampstead, London. NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.J.M., Wallis-Jones S., Little A.M.;
RT   "Exon 2 of a new HLA-DPB1 allele DPB1*XX exhibits a single nucleotide
RT   difference G255A from DPB1*020102 leading to synonymous coding for glutamic
RT   acid at residue 56";
RL   Unpublished.
XX
DR   MD5; cf0494c614c5a694734b9f6ffdc3332b.
DR   Ensembl-Gn; ENSG00000229295; homo_sapiens.
DR   Ensembl-Tr; ENST00000415996; homo_sapiens.
DR   Ensembl-Tr; ENST00000445925; homo_sapiens.
DR   Ensembl-Tr; ENST00000447783; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="SHNA4805AN"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B5U8B5"
FT                   /db_xref="IMGT/HLA:DPB1*02:01:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B5U8B5"
FT                   /protein_id="CAR66501.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 264 BP; 62 A; 64 C; 97 G; 41 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaagagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer