Dbfetch

ID   FM210785; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FM210785;
XX
DT   23-SEP-2008 (Rel. 97, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC Class II antigen, HLA-DPB1*8001
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (15-SEP-2008) to the INSDC.
RL   McWhinnie A.J.M., Anthony Nolan Research Institute, Royal Free Hospital,
RL   Fleet Road, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.J., Little A.M.;
RT   "Full exon 2 confirmatory sequence of HLA-DPB1*8001 from cell line CC and
RT   correction to the assigned DPB1 tissue type on the IMGT/HLA database.";
RL   Unpublished.
XX
DR   MD5; 159b5eea4834eee3e1f72490d1959142.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8001"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B5U899"
FT                   /db_xref="IMGT/HLA:DPB1*80:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B5U899"
FT                   /protein_id="CAR66423.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8001"
FT                   /number=2
XX
SQ   Sequence 264 BP; 62 A; 65 C; 96 G; 41 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggacta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//