spacer

EBI Dbfetch

ID   FM210110; SV 1; linear; genomic DNA; STD; INV; 360 BP.
XX
AC   FM210110;
XX
DT   04-NOV-2008 (Rel. 97, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 2)
XX
DE   Drosophila madeirensis partial Obp83a gene for putative olfactory specific
DE   F protein precursor
XX
KW   .
XX
OS   Drosophila madeirensis
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC   Drosophilidae; Drosophila; Sophophora.
XX
RN   [1]
RP   1-360
RA   Sanchez-Gracia A.;
RT   ;
RL   Submitted (04-SEP-2008) to the INSDC.
RL   Sanchez-Gracia A., Animal Phylogeny and Systematics, Institut de Biologia
RL   Evolutiva, CSIC-UPF, Passeig Maritim de la Barceloneta, 37-49, 08003
RL   Barcelona, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-323.
RX   PUBMED; 19038039.
RA   Sanchez-Gracia A., Rozas J.;
RT   "Divergent evolution and molecular adaptation in the Drosophila
RT   odorant-binding protein family: inferences from sequence variation at the
RT   OS-E and OS-F genes";
RL   BMC Evol. Biol. 8(1):323-323(2008).
XX
DR   MD5; 0c0fabaaa7b2ec293ed16e0e1489d5df.
DR   EuropePMC; PMC2631505; 19038039.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..360
FT                   /organism="Drosophila madeirensis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:30013"
FT   CDS             <1..>360
FT                   /gene="Obp83a"
FT                   /standard_name="Olfactory Specific E"
FT                   /product="putative olfactory specific F protein precursor"
FT                   /function="odorant binding protein"
FT                   /db_xref="GOA:B6VK22"
FT                   /db_xref="InterPro:IPR006170"
FT                   /db_xref="InterPro:IPR023316"
FT                   /db_xref="UniProtKB/TrEMBL:B6VK22"
FT                   /protein_id="CAR65041.1"
FT                   /translation="RDENYPPPGIMKMAKPFHDSCVEKTGVTEAAIKEFSDGDIHEDEK
FT                   LKCYMNCFFHEIEVVDDNGDVHLEKFFATVPLSIRDKLMEMSKDCVHPEGDSLCQKAWW
FT                   FHQCWKKADPKHYFLV"
FT   mat_peptide     <1..>360
FT                   /gene="Obp83a"
FT                   /standard_name="Olfactory Specific E"
FT                   /product="putative olfactory specific F protein"
XX
SQ   Sequence 360 BP; 91 A; 81 C; 102 G; 86 T; 0 other;
     cgtgacgaga actatccacc gccgggcata atgaaaatgg cgaaaccctt ccacgattcc        60
     tgtgtggaga aaacgggcgt caccgaggcg gccatcaagg agttcagcga cggggacata       120
     cacgaggacg agaagctcaa gtgctacatg aattgcttct tccacgagat cgaagtggtt       180
     gacgataatg gcgatgttca cttggagaaa ttctttgcca ctgttccgct ctccattcgg       240
     gataagttga tggaaatgtc caaggattgt gtgcatcccg agggtgattc gttgtgccag       300
     aaggcctggt ggttccatca gtgctggaaa aaggccgatc ctaagcatta ctttttggtt       360
//


spacer
spacer