spacer

EBI Dbfetch

ID   FM179954; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FM179954;
XX
DT   11-OCT-2008 (Rel. 97, Created)
DT   11-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*1110, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (10-JUL-2008) to the INSDC.
RL   Poli F., Medicina Rigenerativa, Ospedale Maggiore Policlinico di Milano,
RL   Via Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB*1110 by direct sequencing";
RL   Unpublished.
XX
DR   MD5; a4cfae4ea4ffa41ba439fee090a163f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1110"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B6ET91"
FT                   /db_xref="IMGT/HLA:DRB1*11:10:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B6ET91"
FT                   /protein_id="CAQ77244.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1110"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 63 C; 98 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer