spacer

EBI Dbfetch

ID   FM179947; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   FM179947;
XX
DT   11-AUG-2008 (Rel. 96, Created)
DT   11-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*08new
DE   allele, isolate ID 070685, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Danzer M.;
RT   ;
RL   Submitted (11-JUL-2008) to the INSDC.
RL   Danzer M., Genomics, Transfusion Service of Upper Austria,
RL   Krankenhausstrasse 7, A-4017 Linz, AUSTRIA.
XX
RN   [2]
RA   Danzer M.;
RT   "Identification of a new HLA-B*08 allele";
RL   Unpublished.
XX
DR   MD5; f1e88327822d7017febdcad45563e9c1.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000445222; homo_sapiens.
DR   Ensembl-Tr; ENST00000461583; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="ID 070685"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5B8Y7"
FT                   /db_xref="IMGT/HLA:B*08:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8Y7"
FT                   /protein_id="CAQ77247.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08new"
FT                   /number=3
XX
SQ   Sequence 792 BP; 145 A; 264 C; 284 G; 99 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg acccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagagcatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacacgc       780
     tggagcgcgc gg                                                           792
//


spacer
spacer