spacer

EBI Dbfetch

ID   FM179945; SV 1; linear; genomic DNA; STD; HUM; 796 BP.
XX
AC   FM179945;
XX
DT   11-AUG-2008 (Rel. 96, Created)
DT   11-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*07new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RA   Danzer M.;
RT   ;
RL   Submitted (11-JUL-2008) to the INSDC.
RL   Danzer M., Genomics, Transfusion Service of Upper Austria,
RL   Krankenhausstrasse 7, A-4017 Linz, AUSTRIA.
XX
RN   [2]
RA   Danzer M.;
RT   "Identification of a new HLA-Cw*07 allele";
RL   Unpublished.
XX
DR   MD5; 82b9f88e2408cfe7b5e0965128c0996b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,521..>796)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5B8Y5"
FT                   /db_xref="IMGT/HLA:C*07:62"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8Y5"
FT                   /protein_id="CAQ77245.1"
FT                   /translation="SYSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   intron          271..520
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   exon            521..796
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
XX
SQ   Sequence 796 BP; 139 A; 264 C; 286 G; 107 T; 0 other;
     gctcctactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgccca gagtctcccc gtctgagatc       360
     caccccaagg tggatctgcg gaacccgccc agaccctcga ccggagagag ccccagtcgc       420
     ctttacccgg tttcattttc ggtttaggcc aaaatccccg cgggttggtc ggggcggggc       480
     ggggctcggg ggactgggct gaccgcgggg gcggggccag ggtctcacac cctccagagg       540
     atgtctggct gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc       600
     tacgacggca aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac       660
     accgcggctc agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga       720
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       780
     acgctgcagc gcgcag                                                       796
//


spacer
spacer