spacer

EBI Dbfetch

ID   FM177765; SV 1; circular; genomic DNA; STD; MAM; 16792 BP.
XX
AC   FM177765;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Helarctos malayanus complete mitochondrial genome
XX
KW   complete genome.
XX
OS   Helarctos malayanus (Malayan sun bear)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Helarctos.
OG   Mitochondrion
XX
RN   [1]
RP   1-16792
RA   Krause J.;
RT   ;
RL   Submitted (23-JUN-2008) to the INSDC.
RL   Krause J., Evolutionary Genetics, Max Planck Institute, Deutscher Platz 6,
RL   04103 Leipzig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-220.
RX   PUBMED; 18662376.
RA   Krause J., Unger T., Nocon A., Malaspinas A.S., Kolokotronis S.O.,
RA   Stiller M., Soibelzon L., Spriggs H., Dear P.H., Briggs A.W., Bray S.C.E.,
RA   O'Brien S.J., Rabeder G., Matheus P., Cooper A., Slatkin M., Paabo S.,
RA   Hofreiter M.;
RT   "Mitochondrial genomes reveal an explosive radiation of extinct and extant
RT   bears near the Miocene-Pliocene boundary";
RL   BMC Evol. Biol. 8:220-220(2008).
XX
DR   MD5; 8ac4f514565abc2d885eddc78fe8b12d.
DR   EuropePMC; PMC2518930; 18662376.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16792
FT                   /organism="Helarctos malayanus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9634"
FT   D-loop          join(1..892,16337..16792)
FT   repeat_region   221..560
FT                   /rpt_type=TANDEM
FT                   /note="microsatellite"
FT   tRNA            893..960
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT   rRNA            961..1924
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   tRNA            1925..1990
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT   rRNA            1991..3570
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            3571..3645
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             3648..4603
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:4602..4603,aa:TERM)
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QWA6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA6"
FT                   /protein_id="CAQ68482.1"
FT                   /translation="MFMINIISLVVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGL
FT                   LQPVADAVKLFTKEPLRPLTSSTTMFIMAPILALTLALTMWVPLPMPYPLVNMNLGVLF
FT                   MLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFALS
FT                   TLITTQEHLWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAL
FT                   FFLAEYANIIMMNAFTTILFFGAFHNPYMPELYTVNFTVKTLLLTASFLWIRASYPRFR
FT                   YDQLMHLLWKNFLPLTLALCMWHVTLPIITASVPPQM"
FT   tRNA            4604..4672
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            complement(4670..4742)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            4744..4812
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT   CDS             4813..5854
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:5854,aa:TERM)
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QWA7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA7"
FT                   /protein_id="CAQ68483.1"
FT                   /translation="MKPPIFIIITSTIVLGTMIVLFSSHWLMIWIGFEMNMLAIIPILM
FT                   KKSNPRAMEASTKYFLTQATASMLLMLGIIINLLYSGHWTISMIPNPIASTVITIALAM
FT                   KLGLSPFHFWVPEVTQGIPLSSGVILLTWQKIAPLSVLYQISPSINPNLLVTLAATSVL
FT                   VGGWGGLNQTQLRKILAYSSIAHMGWMAAIMVYNPTLMILNLAIYIMMTLGTFMLFMHN
FT                   LSTTTLSLSHTWNKSPLIASLILALMLSLGGLPPLSGFIPKWMIIQELTKNDMIVMPTF
FT                   MAITALLNLYFYMRLTYATALTMFPSANNMKMKWQFESTKKMILLPPLIVASTMLLPLA
FT                   PMLSIMD"
FT   tRNA            5855..5921
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT   tRNA            complement(5930..5998)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT   tRNA            complement(5999..6071)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(6105..6171)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT   tRNA            complement(6172..6238)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   CDS             6240..7784
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxI"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="GOA:A8QWA8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA8"
FT                   /protein_id="CAQ68484.1"
FT                   /translation="MFMNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPG
FT                   TLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAIN
FT                   FITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMW
FT                   ALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL
FT                   FSGYTLNNTWAKVHFMIMFIGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGS
FT                   FISLTAVMLMIFMIWEAFASKREVAVVELTSTNIEWLHGCPPPYHTFEEPTYITLK"
FT   tRNA            complement(7782..7850)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            7857..7923
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT   CDS             7924..8607
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxII"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="GOA:A8QW96"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:A8QW96"
FT                   /protein_id="CAQ68485.1"
FT                   /translation="MAYPLQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISTM
FT                   LTTKLTHTSTMDAQEVETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQW
FT                   YWSYEYTDYEDLGFDSYMTPTQELKPGELRLLEVDNRVVLPVEMTIRILISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPIVLELVPLSYFEKW
FT                   SASML"
FT   tRNA            8611..8678
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT   CDS             8681..8884
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="atp8"
FT                   /product="ATP synthase F0 subunit 8"
FT                   /db_xref="GOA:B5B8M7"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8M7"
FT                   /protein_id="CAQ68486.1"
FT                   /translation="MPQLDTSTWSVTILSMVLALFIVFQLKVSKYKYPETPTPKSFSLS
FT                   KKLMPWEEKWTKIYSPLLLPQR"
FT   CDS             8842..9521
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:9520..9521,aa:TERM)
FT                   /gene="atp6"
FT                   /product="ATP synthase F0 subunit 6"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QW98"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:A8QW98"
FT                   /protein_id="CAQ68487.1"
FT                   /translation="MNENLFTSFITPTMMGIPVVVLIVMSPSILFPSPSRLIDNRLVSI
FT                   QQWLVRLTSKQMLSTHNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGM
FT                   AIPLWAGTVAIGFRYKTKASLAHFLPQGTPFPLIPMLVIIETISLFIQPMALAVRLTAN
FT                   ITAGHLLIHLIGGATLALINISTITALITFTILVLLTILEFAVALIQAYVFTLLVSLYL
FT                   HDNT"
FT   CDS             9522..10305
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10305,aa:TERM)
FT                   /gene="coxIII"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QW99"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:A8QW99"
FT                   /protein_id="CAQ68488.1"
FT                   /translation="MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSMFLLSL
FT                   GLTTNMLTMYQWWRDIIRESTFQGHHTPVVQKGLRYGMVLFIVSEVFFFAGFFWAFYHS
FT                   SLAPTPELGACWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGSRKHMLQAL
FT                   FITISLGVYFTLLQASEYYEASFTISDGVYGSTFFMATGFHGLHVIIGSTFLTICFLRQ
FT                   LHFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
FT   tRNA            10306..10374
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT   CDS             10375..10721
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10720..10721,aa:TERM)
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:Q3L6P7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L6P7"
FT                   /protein_id="CAQ68489.1"
FT                   /translation="MNLILALFTNMLLASLLVLIAFWLPQSNIYMEKASPYECGFDPMG
FT                   SARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTDNLMTMLTMALLLISLLAVSLAY
FT                   EWAEKGLEWAE"
FT   tRNA            10722..10790
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT   CDS             10791..11087
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:A8QWA1"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA1"
FT                   /protein_id="CAQ68490.1"
FT                   /translation="MPVVYVNIFLAFIVSLTGLLIYRSHLMSSLLCLEGMMLSLFVMLT
FT                   VTVLNNHFTLANMAPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC"
FT   CDS             11081..12458
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:12458,aa:TERM)
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8N2"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8N2"
FT                   /protein_id="CAQ68491.1"
FT                   /translation="MLKIIFPTMMLVPLTWASKSNMIWINTTAYSLLISLISLTYLNQL
FT                   SDNSLNFSLLFFTDSLSAPLLALTTWLLPLMLMASQFHLSKETLTRKKLYITMLILLQL
FT                   FLIMTFSAMELILFYILFEATLIPTLVIITRWGNQTERLNAGLYFLFYTLVGSLPLLVA
FT                   LLHTQNNLGSLNFLVMQYWAQPLPNSWSSMFLWLACMMAFMVKMPLYGLHLWLPKAHVE
FT                   APIAGSMVLAAVLLKLGGYGMMRITTLLHPLTSFMAYPFMMLSLWGMIMTSSICLRQTD
FT                   LKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERVHSR
FT                   TMILARGLQTLLPLMAAWWLLASLTNLALPPTINLIGELFVVVATFSWSNITITLMGTN
FT                   IIITALYSLYMLITTQRGKYTDHVKSIKPSFTRENALMALHLLPLLLLSLNPKMILGPI
FT                   Y"
FT   tRNA            12459..12527
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT   tRNA            12528..12586
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            12587..12656
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             12657..14477
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:A8QWA3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA3"
FT                   /protein_id="CAQ68492.1"
FT                   /translation="MNLLTSSIITTLLMLTVPIILTNASTHKNKFYPQYVKTTISYAFM
FT                   ISTIPMMMFLYSGQEVIISNWHWMTIQTLKLTLSFKLDYFSMIFMPVALFVTWSIMEFS
FT                   IWYMHTDPNINQFFKYLLMFLVTMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAVLYNRIGDVGFIMAMAWFLLNANAWDFQQIFAIEHDNLNIPLAGLLLAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFHPLMEHNKTIQTAALCLG
FT                   AMTTLFTAVCALTQNDIKKIIAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLF
FT                   MCSGSIIHSLNDEQDIRKMGGLFKALPFTTTALIIGTLALTGMPFLTGFYSKDLIIETA
FT                   NTSYTNAWALLTTLIATSMTAAYSTRIVFFALLGQPRFNPAVVINENNPLLINSIKRLL
FT                   LGSIFAGYLISHNITPTTIPQMTMPHYLKTTALAVTMLGFILALELNSTMQGLKFNYPQ
FT                   NPFKFSNQLGYFPTIIHRLLPMMSLSMSQKMASMLLDSTWLESVLPKSISYFQMKSSIT
FT                   VSNQKGLIKLYFLSFMITLILSFFVLNFHE"
FT   CDS             complement(14461..14988)
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:A8QWA4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA4"
FT                   /protein_id="CAQ68493.1"
FT                   /translation="MMMYIVFILSVVFVMGFVGFSSKPSPIYGGLVLIISGGAGCGIVL
FT                   NFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLGAFIVGLLSELLIA
FT                   CYVLKDDEVEVVFKFNGVGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLI
FT                   GVLVIMEVTRGN"
FT   tRNA            complement(14989..15057)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT   CDS             15062..16201
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A8QWA5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA5"
FT                   /protein_id="CAQ68494.1"
FT                   /translation="MTNIRKTHPLAKIINNSLIDLPAPSNISAWWNFGSLLGVCLILQI
FT                   MTGLFLAMHYTSDTTTAFSSITHICRDVHYGWIIRYMHANGASMFFICLFMHVGRGLYY
FT                   GSYLFSETWNIGIILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   VWGGFSVDKATLTRFFAFHFILPFIILALTAVHLLFLHETGSNNPSGIPSDSDKIPFHP
FT                   YYTIKDILGALLLTLALTTLVLFSPDLLGDPDNYIPANPLSTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVFSILILAIIPLLHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGG
FT                   QPVEHPFTIIGQLASILYFMIFLVFMPIAGIIENNLSKW"
FT   tRNA            16202..16271
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(16271..16336)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
XX
SQ   Sequence 16792 BP; 5230 A; 4301 C; 2583 G; 4678 T; 0 other;
     gatcacacat aactgtggtg tcatgcattt ggtatctttt aatttttggg gggggaactt        60
     gctatgactc agctatgacc gtaaaggtct cgtcgcagtc aaataacttg tagctgggct       120
     tatttatctt tcacgggtcg ggcatagata cccataaggg gctattcagt caatggttac       180
     aggacatata gaatacaaat accactagat cgaacggacg acgcacgtgt acgcatgtgt       240
     acgcatgtgt acgcatgtgt acgcacgtgt acgcatgtgt acgcatgtgt acgcacgtgt       300
     acgcatgtgt acgcacgtgt acgcatgtgt acgcacgtgt acgcacgtgt acgcacgtgt       360
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       420
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       480
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       540
     acgcacgtgt acgcacgcgt ttttagatat taacttagct taatcaaacc ccccttaccc       600
     cccgtaactt caaggagctt acgcacattt atgattgtct tgccaaaccc caaaaacaag       660
     actaaatgta cgtgcaaaca tgaagctatt atacccaaaa tcccacataa taagctaaaa       720
     tttccggcca aataattatt acaatcacag gcgtgaaact tcaaattaag atctatctat       780
     agatatattt ttttttactc tgtctccctc ctattgattt ttccgttatt atcatttttt       840
     ttggctacaa acttccacca aattacccta tacaaacccc aaaaccaact acgtccatgt       900
     agcttaataa taaagcaagg cactgaaaat gcctagacga gttatataac tccatgaaca       960
     taaaggtttg gtcctagcct tcccattagc tactaataag attacacatg taagtctccg      1020
     cgctccagtg aaaatgccct ttggatctta aagcgatttg aaggagcggg catcaagcac      1080
     acctctccct ggtagcttat aacgccttgc ttagccacgc ccccacggga tacagcagtg      1140
     ataaaaatta agccatgaac gaaagttcga ctaagctatg ttgattaagg gttggttaat      1200
     ttcgtgccag ccaccgcggt tatacgattg acccgagtta atgggcccac ggcgtaaagc      1260
     gtgtgaaaga aaaatttctc ccccactaaa gttaaagttt agtcaagctg taaaaagctg      1320
     tcaataatac taaaataaac tacgaaagtg actttaatac tctcaaccac acgacagcta      1380
     aggcccaaac tgggattaga taccccacta tgcttagcct taaacataaa taatttatta      1440
     aacaaaatta ttcgccagag aactactagc aacagcttaa aactcaaagg acttggcggt      1500
     gctttagacc cctctagagg agcctgttct gtaatcgata aaccccgata gacctcacca      1560
     cctcttgcta atccagtcta tataccgcca tcttcagcaa acccttaaaa ggaacaagag      1620
     taagcacaat catcccacat aaaaaagtta ggtcaaggtg taatccatgg ggtgggaaga      1680
     aatgggctac attttctatt caagaacatt tacgaaagtt tttatgaaac taaaaactaa      1740
     aggtggattt agcagtaaac caagaataga gagcttggtt gaacaaggca atggagcacg      1800
     cacacaccgc ccgtcaccct cctcaagtgg cacaagtcaa atataaccta ttgaaaccaa      1860
     ataaaacgca agaggagaca agtcgtaaca aggtaagcat actggaaagt gtgcttggat      1920
     aaaccaaagt gtagcttaaa taaagcatct ggcttacacc cagaagattt cacgtatgtg      1980
     accgctttga accctgaact agcccagaca ataaccaatc aaattactac aggccaatta      2040
     aacaaatcat ttagtaatct aattaaagta taggagatag aaattctttt agtcggagct      2100
     atagagaaag taccgcaagg gaatgatgaa agattactta aagtgataaa cagcaaagat      2160
     tacccctttt accttttgca taatgagtta gccagaagta acctaacaaa gagaacttaa      2220
     gctaggtccc ccgaaaccag acgagctacc tatgaacaac cccctggggt gaactcgtct      2280
     atgtcgcaaa atagtgagaa gattcatagg tagaggtgaa aagcctaacg agcctggtga      2340
     tagctggttg cccagaatag aattttagtt caactttaaa cctgcctaca aaacttaaaa      2400
     attttaatgc aggtttaaaa tatattctaa aaaggtacag ctttttagaa tcgaggatac      2460
     aaccttactt agagagtaaa tactgattaa atcatagtag gcctagaagc agccatcaat      2520
     taagaaagcg tttaagctca acatccatat caacttaata ccaaaaatat ctaattaact      2580
     cctaatataa caactgggct aatctatttt aatatagaag caataatgct aatatgagta      2640
     acgagaaata tttctccaac gcataagctt ataacagcaa cggataacca ctgatagtta      2700
     acaacaacgt agaaataatc taacaataaa acatctacca aaccaattgt taatccaaca      2760
     caggtatgcg actaaggaaa gattaaaaga agtaaaagga actcggcaaa cacaaatccc      2820
     gcctgtttac caaaaacatc acctccagca ttcccagtat tggaggcact gcctgcccgg      2880
     tgacattagt taaacggccg cggtattctg accgtgcaaa ggtagcataa tcatttgttc      2940
     tctaaataag gacttgtatg aatggccaca cgaggattta actgtctctt acttccaatc      3000
     agtgaaattg accttcccgt gaagaggcgg gaataaaaca ataagacgag aagaccctat      3060
     ggagctttaa ttaactagct caaaagaacc tatttaccag accgacagga acaacatact      3120
     cctttcatga gctagcaatt taggttgggg cgacctcgga gtataaaaca acctccgagt      3180
     gatattagtc tagacgtacc agtcaaaatg ctcacttact tattgatcca aaactttttt      3240
     gatcaacgga ataagttacc ctagggataa cagcgcaatc ctatttaaga gtccatatcg      3300
     acaatagggt ttacgacctc gatgttggat caggacatcc taatggtgca gcagctatta      3360
     agggttcgtt tgttcaacga ttaaagtcct acgtgatctg agttcagacc ggagcaatcc      3420
     aggtcggttt ctatctattt aaacaacttc tcccagtacg aaaggacaag agaagtaagg      3480
     cccccctcac taaagcgcct taagaccaat agatgattta atctaaatct agtaagtcta      3540
     cccccaatac cgcccaagag acagggcttc gctagggtgg cagaatctgg tgattgcata      3600
     aaacttaaac ctttatactc agaggttcaa atcctctccc tagcattatg tttataatta      3660
     acatcatctc actagtcgta cccattctcc tcgccgtagc ctttttaaca ctagtagagc      3720
     gaaaagtact tggctatatg caactccgta aaggaccaaa cattgtagga ccctatggtc      3780
     tcctgcaacc tgttgcagat gctgtaaagc ttttcaccaa agaacccctg cgccccctca      3840
     catcatctac gactatattc attatagccc ctattctagc cctaacacta gccctaacca      3900
     tgtgagttcc cctaccaata ccataccccc ttgtcaacat aaacctcgga gtactattta      3960
     tgctggcaat atcaagccta gctgtgtact ctatcctttg atcaggatga gcttcaaact      4020
     caaaatacgc tctgattgga gctctgcgag ccgtagccca gacaatttcg tatgaagtta      4080
     cactagccat tatcctccta tcagtcctac taatgaatgg ctcattcgca ctctccacct      4140
     taattactac tcaagagcac ctctgactaa tcttccctgc atgaccccta gctataatat      4200
     gatttatttc caccctagca gaaactaacc gagccccctt cgacctgaca gaaggagaat      4260
     cagaactagt ctcaggcttt aacgtcgaat atgcagcagg cccattcgcc ctatttttcc      4320
     tagcagaata tgctaatatc atcataataa atgccttcac gactatccta ttcttcgggg      4380
     catttcacaa cccctacata ccagaactgt atactgtcaa tttcactgta aaaacactac      4440
     tcctaacagc ttccttccta tgaatccgtg catcataccc ccgattccga tatgaccaac      4500
     taatgcactt attatgaaaa aacttcctac cccttacact agccctatgc atatgacatg      4560
     taacactacc cattatcaca gcaagcgtcc ctcctcagat ataagaaata tgtctgacaa      4620
     aagaattact ttgatagagt aaataataga ggttggaatc ctcttatttc tagaatcata      4680
     ggaattgaac ctaatcttaa gaactcaaaa atcttcgtgc tacctaatta caccatatcc      4740
     tagagtaagg tcagctaaat aagctatcgg gcccataccc cgaaaatgtt ggtttatccc      4800
     cttcccatac taataaaacc ccccattttt atcattatca catccaccat tgttctagga      4860
     accataatcg ttttatttag ctcccattga ctcataatct gaattggttt tgaaataaat      4920
     atgctagcta ttatcccaat cctaatgaaa aaatctaatc cgcgagccat ggaagcctcc      4980
     acaaaatatt ttctcacaca agccactgca tccatgctcc taatactagg catcattatt      5040
     aatctgctat actcaggaca ctgaacaatc tcaataattc ccaacccaat tgcatcaacc      5100
     gtaattacta tcgccctagc aataaaactc ggcctatccc cttttcactt ctgagtccca      5160
     gaggtcacac aaggcattcc tttatcctca ggagtgattc tactaacatg acagaaaatc      5220
     gcacctctat ccgtcctata tcaaatttca ccatccatca acccaaacct actagtaaca      5280
     ttagccgcta catccgtatt agtaggaggc tgaggaggac taaaccaaac ccaacttcga      5340
     aaaattctag catactcttc aatcgctcac atgggctgaa tagctgccat catagtatat      5400
     aatcccaccc taataatcct caaccttgca atctacatca taataactct aggaacattt      5460
     atactattta tacacaatct atctacaaca acactatcgc tatcccacac atgaaataaa      5520
     tcaccactaa tcgcctcgct aattctagca ctcatactat cgctaggcgg ccttcctccc      5580
     ctctcaggct tcattcccaa atgaataatc attcaagagc taacaaaaaa tgatataatt      5640
     gttatgccca cattcatagc cattacagcc ctactaaacc tttatttcta catgcgccta      5700
     acatacgcca cggcactaac aatatttccc tccgcaaata atataaaaat aaaatgacaa      5760
     tttgaaagca caaaaaaaat aattctctta ccccctctga tcgtagcatc aaccatactc      5820
     ctcccactag ctccaatact atcaatcatg gactagagat ttaggctaaa gagaccgagg      5880
     gccttcaaag ccctaagtaa gtgaaactca cttaatctct gcaactattt aaggactgca      5940
     agaacttatc tcacatcaat tgaacgcaaa acaaccgctt taattaagct aagccctcct      6000
     agattggcgg gcttttatcc cacaaaattt tagttaacag ctaaaaaccc caaacaactg      6060
     gcttcaatct acttctcccg ccgcgtagaa aaaaaaggcg ggagaagccc cggcagaatt      6120
     gaatctgctt ctttgaattt gcaattcaat atgataactc accacagagc ttggcaaaaa      6180
     ggggacttaa cctctattct tagatttaca gtctagtgct tttatcagcc attttaccta      6240
     tgttcataaa ccgatgacta ttctctacaa accacaaaga cattggtacc ctttaccttc      6300
     tgttcggtgc gtgagccggg atagtaggta ctgccctcag ccttttaatt cgtgccgagc      6360
     taggccagcc cgggactttg ttgggggatg atcagatcta caatgtaatc gtaactgccc      6420
     atgcgttcgt gataatcttc ttcatagtca tgcctattat aattggggga ttcgggaact      6480
     gattagtgcc cttaataatt ggtgcccccg acatagcgtt tcctcgaata aataacataa      6540
     gcttctgact gctgccacca tctttcttat tactcctagc ctcttctatg gtagaagcag      6600
     gtgcagggac tggatgaact gtctatcccc ctctagcagg caatctagcc catgcaggag      6660
     catcagtaga cttgacaatc ttttctctac atttagcagg catttcttcc attctgggag      6720
     ctattaattt cattactact atcattaata tgaaaccccc agcaatgtcc caataccaga      6780
     ctcctctgtt tgtatgatca gtcctaatta cggcagtact tcttctttta tccctgccag      6840
     tcttagcagc cggaattact atacttctta cagatcgaaa ccttaatact accttttttg      6900
     atccggccgg agggggagac cctattctat atcaacactt gttttgattc ttcgggcacc      6960
     ccgaggttta catcctaatt cttccagggt tcggaataat ctctcatatt gtcacttatt      7020
     actcaggaaa aaaagaacct tttggctaca taggaatagt ctgagcaata atatctattg      7080
     ggttcctagg atttatcgtg tgagctcacc atatgtttac tgtagggata gacgtcgaca      7140
     cacgagctta ctttacctca gctaccataa ttattgcaat cccaacagga gttaaagtat      7200
     ttagctgact agccactctg cacggaggga atattaaatg atctcccgct ataatatgag      7260
     ccctaggctt tattttcctg tttacagtgg gaggcctaac aggaattgtc ctagctaatt      7320
     cgtccttaga cattgttctc catgacacat attatgtggt agctcatttc cactatgtat      7380
     tatcaatggg ggctgtcttt gccattatag gaggatttgt ccactgattt ccgctgtttt      7440
     caggctacac acttaataat acatgagcaa aagttcactt cataattata ttcattgggg      7500
     ttaatatgac attctttccc cagcactttc taggcctgtc aggaatacct cggcgatatt      7560
     ccgattatcc agatgcctat acaacatgaa atacagtatc ttctataggc tcattcattt      7620
     cactaacagc agttatactg ataattttca tgatctggga ggcctttgca tcaaaacgag      7680
     aggtggcagt ggtagaactc acctcaacca acattgaatg actacacgga tgtcctcctc      7740
     catatcacac attcgaagaa cccacttaca tcacactaaa ataagaaagg aaggaatcga      7800
     accctctgga attggtttca agccaatatc ataaccacta tgcctttctc aataaagaga      7860
     tattagtaaa aattacataa ctttgtcagg gttaaattat aggtgaaaat cctttatatc      7920
     tttatggcgt acccccttca aataggtctt caagacgcaa cttctcctat catagaggaa      7980
     ctcctacact ttcatgacca cacattaata attgtgttcc taattagctc cttagttctc      8040
     tatattattt caactatatt aactaccaaa ttaacgcaca caagcacaat ggacgcacaa      8100
     gaagtagaga cggtgtgaac catcctgcca gctattatcc taattctaat tgcactccca      8160
     tcactacgga ttctctacat aatggatgaa attaataatc cctcactgac tgtaaaaacc      8220
     ataggtcatc aatgatactg aagctatgag tatacagatt atgaagatct aggctttgac      8280
     tcttatatga ctccaacaca agaactaaag cctggggagc tgcggttatt agaagtggac      8340
     aatcgagtag tactgcctgt agaaataaca atccgtatcc tgatctcgtc agaagatgtc      8400
     ttacactcat gagctgtgcc atctctggga ttaaaaactg atgcaatccc aggacggctg      8460
     aatcaaacaa ctctcatagc catgcgacca ggattatact acggccaatg ctcagaaatt      8520
     tgtggctcca accacagttt tatacctatt gtcctcgagc tagtcccact atcttacttt      8580
     gaaaaatggt ctgcctcaat gctatagaat cattaagaag ctaatatagc attaaccttt      8640
     taagttaaag actgagaatg caaacttctc cttaatgaag atgccacaac tagacacatc      8700
     aacatgatct gtcacaatcc tgtctatagt tctagcacta tttattgtgt tccagctaaa      8760
     agtctcaaaa tacaagtatc ctgaaacccc cacaccgaaa tctttctcac tatcaaagaa      8820
     acttataccc tgagaagaaa aatgaacgaa aatctattca cctcttttat taccccaacg      8880
     ataataggga ttcctgttgt agtcctaatt gtcatgtctc cgagcatttt atttccttct      8940
     cccagtcggc taatcgacaa ccgcttggta tctattcaac agtgactagt ccgactaaca      9000
     tcaaaacaaa tactatccac ccataatcac aaaggacaaa cctgagcact aatgttaata      9060
     tcattaatcc tatttattgg ctcaactaat cttctaggcc tattaccaca ctcattcaca      9120
     cctaccacac agctgtcaat gaacctggga atggctattc ccctgtgagc aggtacagtt      9180
     gctatcgggt tccgatataa gaccaaagca tccctggctc actttctacc ccaaggaaca      9240
     ccttttcctc taatccctat actcgtaatt attgaaacaa ttagcctgtt catccagccc      9300
     atggccttag ccgttcgact gaccgctaat attactgcag gccacttgct catccattta      9360
     attgggggag ctactttggc tctaattaac atcagcacca ttacagccct tattaccttt      9420
     actattttag tgctactcac tattctcgag ttcgctgtgg ccctcattca ggcctacgtc      9480
     ttcactctgc tagtaagcct atacttacat gataacactt aatgactcac caaacacacg      9540
     catatcacat agtcaaccca agtccatgac cactgacagg ggccctttca gcccttctaa      9600
     taacatcagg actaattata tgatttcact ttaactctat attcttgtta tcactaggcc      9660
     ttacaactaa tatacttact atataccaat ggtggcggga tattattcga gagagcacct      9720
     ttcaaggcca tcacacccct gttgtccaaa aggggctacg gtacgggata gtcctattta      9780
     tcgtatcaga agtattcttc ttcgcaggat tcttctgagc tttttaccac tcaagcctag      9840
     cacccactcc cgaactagga gcatgctgac cacccacagg tattactccc ctaaatccgc      9900
     tagaagtacc actcctcaac acttcagtgc ttcttgcatc cggagtgtcc attacctgag      9960
     cccaccatag tctaatagag ggaagccgca aacatatgct gcaagcccta tttattacta     10020
     tctctctagg cgtgtacttc acacttctac aagcctcaga gtactatgag gcatccttca     10080
     ctatttcaga tggagtctat ggctcaactt ttttcatagc gactgggttt cacggacttc     10140
     atgtaatcat tggctcaact ttccttacaa tctgcttcct acggcaacta catttccatt     10200
     tcacatcaag tcaccatttt ggctttgaag cagcagcatg gtattgacac ttcgtagatg     10260
     tcgtgtgact attcctatat gtttccatct attgatgagg atcttgcttc tttagtatcg     10320
     atcagtacaa ttgacttcca atcaatcagc tctggcgcaa cccagaaaga agtaatcaac     10380
     ctaatcctag cactatttac taacatacta ctagcttccc tactcgttct tattgccttc     10440
     tgactgccac agtcaaatat ttacatagag aaagcaagtc cttatgaatg cggattcgac     10500
     cccataggat cggcacgcct ccctttttct ataaaatttt tcctagtagc cattacattc     10560
     ctactatttg atctagaaat tgcactactc ctcccccttc cctgagcatc acaaactgat     10620
     aacctaataa caatactcac catagccctg ctgcttatct ccttattagc cgtaagtctg     10680
     gcctatgagt gagccgaaaa aggtttagag tgggccgaat atgataatta gtttaaacca     10740
     aaacaaatga tttcgactca ttagattatg attaataaca taattatcaa atgcctgtag     10800
     tctatgtcaa cattttctta gccttcatcg tatcccttac aggactactc atttaccgat     10860
     cccatctaat gtcctcccta ctttgcctag agggtataat attatcttta tttgtcatgc     10920
     taacagtaac agttttaaat aaccatttta cacttgccaa catagctcca attatcctac     10980
     tggtattcgc tgcctgtgaa gcagcactag gactgtccct actagtaata gtctccaaca     11040
     cctacggaac tgattacgta caaaacctta acctcttaca atgctaaaaa ttatttttcc     11100
     cactataata ttagtgcccc ttacatgagc atcaaaatcc aatataatct ggattaacac     11160
     aacagcctac agcctgctca ttagtcttat cagcttgaca tatctcaacc agctcagtga     11220
     taatagccta aacttctcac tattattctt taccgactcc ctatcagccc ccttactagc     11280
     ccttacaacg tgactactgc ccttgatact aatggcaagt caattccacc tgtcaaagga     11340
     aactctaacc cgaaaaaaat tatatattac tatgctaatc ctcctacaac tattcctgat     11400
     cataaccttt tccgctatag agctaatcct attttatatc ttgttcgaag ctaccctaat     11460
     tcctactcta gttattatca ctcgatgggg gaatcaaaca gaacgattaa acgcaggtct     11520
     ttactttcta ttttacaccc tagtaggatc tttaccatta ctagttgcac tactacacac     11580
     tcaaaataat ctaggctccc taaactttct cgtaatacaa tactgagccc aacctctgcc     11640
     aaactcctga tccagtatat tcctgtgact ggcgtgtata atggcattca tagtaaaaat     11700
     acctctatat ggcctccact tatgattgcc aaaagcacac gtagaggctc ccatcgcagg     11760
     atctatagta cttgccgccg tgctcctaaa actaggaggc tacggcataa tgcgaatcac     11820
     aacactactt caccctctaa cgagcttcat ggcctatccc ttcataatac tctcgctatg     11880
     gggtataatc ataacaagct ctatttgcct gcgccaaacg gatttaaagt ccctaattgc     11940
     ctactcctct gttagtcaca tagccctagt cattgtagca gtattgatcc aaactccatg     12000
     gagctatata ggagcaacag ccttaataat tgcccacggg ctaacatcct ctatactatt     12060
     ctgccttgca aactccaact acgaacgagt ccatagccga actataatcc ttgcacgagg     12120
     cctacaaaca cttctcccac ttatggcagc ttgatgatta ctagcaagtc ttactaatct     12180
     ggcactccct cctaccatca acctcatcgg agagctattt gtggtagtag ctacattttc     12240
     atgatctaat attaccatca ctctaatagg aactaacatc attattactg ccctctattc     12300
     actctatata ctaatcacca cacaacgagg caaatacaca gaccatgtca aaagcatcaa     12360
     gccatccttc acacgagaaa acgcactaat ggctctccac ctcctacccc ttctgctact     12420
     atccctcaat cccaaaataa ttctaggacc catctactgt aaatatagtt taacaaaaac     12480
     gttagattgt gaatctaata ataaaagccc aagtcttttt atttaccgaa aaagtacaca     12540
     agaactgcta actcatgtgt ccatgcgtaa aatcatggct ttttcaactt ttaaaggata     12600
     gaagtaatcc attggtctta ggaaccaaaa aattggtgca actccaaata aaagtaatta     12660
     acctgcttac ttcctctatt atcacaacct tgctcatact aacagtacca attatcctta     12720
     ctaacgcttc aacacacaaa aacaaattct acccacaata tgtgaaaact acaatttcct     12780
     atgctttcat aatcagtact atccccataa tgatattcct ttactcaggg caagaagtaa     12840
     ttatctcgaa ctgacattga ataactattc aaaccctaaa actaacttta agctttaagc     12900
     tagactactt ctcgataatt ttcatgccag tagccctgtt cgtcacatga tcaatcatag     12960
     aattttccat ttgatatata cacactgacc ccaacatcaa ccaattcttc aaatacctac     13020
     ttatattcct tgttactata ataatcttag taaccgcaaa taatctattc cagctattca     13080
     tcggctgaga gggagtagga atcatatctt tcctcctcat tggatgatga tacggacgaa     13140
     cagacgccaa tacagccgcc ctgcaagcag tcttatataa tcgcatcgga gacgtaggct     13200
     ttatcatagc catagcctga tttttactca atgcaaatgc atgagacttt caacaaatct     13260
     ttgcaattga acatgataat cttaatattc cactagcagg actactccta gcagccactg     13320
     gaaaatcagc ccaatttggc cttcatccat gactcccatc agctatagaa ggacctactc     13380
     ccgtttcagc cctactccac tctagcacaa tagtagtagc aggagtattt cttctaatcc     13440
     gatttcaccc cttgatagaa cacaacaaga ccattcagac agctgctcta tgcttaggag     13500
     caataacaac cctattcaca gcagtctgcg ctcttactca aaatgatatc aaaaagatta     13560
     ttgccttctc cacctcaagc caactaggac taataattgt aacaatcgga attaaccagc     13620
     ctcatctagc atttcttcac atctgtacac acgcattttt taaggccatg ctgtttatat     13680
     gctccggatc catcatccac agcctaaatg acgaacaaga tatccgaaaa ataggaggcc     13740
     tattcaaagc cttaccattt accactaccg cactaattat cggaactctg gcacttacag     13800
     gcatgccttt cctaacagga ttttactcca aagacctaat tatcgagacc gctaacacgt     13860
     catataccaa cgcctgagcc ctactaacaa ctctcattgc cacatccata accgctgcct     13920
     acagtactcg aatcgtattc ttcgcacttc taggacaacc ccgctttaac cccgccgttg     13980
     ttattaacga gaataacccc ctcctaatca attctatcaa acgcctactc ctaggaagca     14040
     tttttgcagg gtatctaatc tcccacaaca ttacacccac caccatccca caaataacta     14100
     taccccatta tcttaaaaca acagcccttg cggtcactat actaggcttt atcctagcac     14160
     tagaactcaa ttctaccata caaggcctca aatttaatta tccacaaaac ccattcaaat     14220
     tttctaatca actaggatat ttccctacta tcattcaccg cctcctacca ataatgagct     14280
     tatcaataag ccaaaagata gcatctatat tattagactc aacctgacta gaaagtgtat     14340
     taccaaaatc tatctcctat ttccaaataa aatcctcaat tacagtctcc aaccagaaag     14400
     ggctaattaa actatatttc ctctctttca taatcacatt aatcctgagc ttcttcgtac     14460
     ttaatttcca cgagtaacct ccataatcac taacacacca atgagaagag atcacccagt     14520
     gacaataacc aatcaggtcc cataactata taaagccgca atccccatag cttcctcact     14580
     aaaaaaccct gaatcccccg tgtcataaat tactcaatct cctaccccat taaatttaaa     14640
     cacaacctca acttcatcgt cttttaagac atagcaggca atcagtagct cagataacag     14700
     acccacaata aatgcgccta atacagcctt attagaaacc caaacctcag gatactgttc     14760
     agtggccata gccgtagtat aaccaaaaac cacaagcatc ccacctaaat aaattaaaaa     14820
     aaccatcaaa cctaaaaaag accctccgaa atttaataca ataccacacc cagcaccccc     14880
     actgataatt aaaaccaacc ctccgtaaat aggagaaggc ttagaagaaa accccacaaa     14940
     acccatcaca aagacgacac ttaaaataaa cacgatatac attatcatta ttctcacatg     15000
     gaatctaacc atgaccaatg acatgaaaaa tcaccgttgt acttcaacta caagaaccct     15060
     aatgaccaac atccgaaaaa cccacccatt agctaaaatc attaacaact cacttattga     15120
     cctcccagca ccatcaaaca tctcggcgtg atgaaacttc ggatccctcc tcggagtatg     15180
     cttaatccta cagattatga caggcctatt tctagccata cactatacat cagacacaac     15240
     cacagccttt tcatcaatca ctcatatctg ccgagacgtt cactacggat gaattatccg     15300
     atatatacat gcaaacggag cctccatgtt ctttatctgc ctattcatgc acgtaggacg     15360
     gggtctgtac tatggctcgt acctattctc agaaacatga aacatcggta ttatcctcct     15420
     atttacagtt atagccaccg catttatagg atacgtcctg ccctgaggcc aaatatcctt     15480
     ctgaggagca actgtcatta ccaatctctt atcagccatc ccctatattg gaacggacct     15540
     agtagaatga gtctgagggg gcttttccgt agacaaagca actctaacac gattctttgc     15600
     cttccacttt atccttccgt tcatcatctt ggcactaaca gcggtccacc tattattcct     15660
     acacgaaaca gggtccaaca atccctctgg aatcccatct gactcagaca aaatcccatt     15720
     tcacccgtac tatacaatta aggacatcct aggcgcccta cttcttaccc tagccctaac     15780
     aaccctagtt ctattctcgc ccgacttact aggagaccct gacaactaca tccccgcaaa     15840
     tccattgagc accccacccc acatcaaacc cgaatggtac tttctatttg cctacgctat     15900
     cctacgatcc attcccaaca aactaggagg agtactagct ctagtcttct ctatcctaat     15960
     cctagccatt atccccctct tacacacatc caagcaacga ggaatgatat tccgacctct     16020
     gagccaatgc ctattttgac tcctagtagc agacctacta acactaacat gaattggagg     16080
     acaaccagta gaacatccct ttaccattat cggacaacta gcctccattc tctatttcat     16140
     aatcttccta gtattcatac ccatcgctgg aattattgaa aataacctct caaaatgaag     16200
     agtctttgta gtatagtaat taccttggtc ttgtaaacca aaaacggaga atattcaccc     16260
     tccccaagac tcaaggaaga agcaacagcc ccgctatcag cacccaaagc tgatgttcta     16320
     tctaaactat tccctggtac atactactat tccacccaat gccctattta tttcatatat     16380
     atcattctat gtactgtacc atcgtagtat gtttttgagt actccttctt tcattttttt     16440
     tttcccccct atgtacgtcg tgcattaatg gcgtgcccca tgcatataag catgtacata     16500
     ttgtgcttgg tcttacatga ggacctacat ttcaaaagct tgttttgagt gtatagtctg     16560
     taagcatgta tttcacttag tccgggagct tgatcaccaa gcctcgagaa accagcaacc     16620
     cttgcgagta cgtgtacctc ttctcgctcc gggcccatga aatgtggggg tttctatgtt     16680
     gaaactatac ctggcatctg gttcttactt cagggccatg ttagctctag attccaatcc     16740
     tactaaccct tcaaatggga catctcgatg gactaatgac taatcagccc at             16792
//


spacer
spacer