Dbfetch

ID   FM177764; SV 1; circular; genomic DNA; STD; MAM; 16752 BP.
XX
AC   FM177764;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Tremarctos ornatus complete mitochondrial genome
XX
KW   complete genome.
XX
OS   Tremarctos ornatus (spectacled bear)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Tremarctos.
OG   Mitochondrion
XX
RN   [1]
RP   1-16752
RA   Krause J.;
RT   ;
RL   Submitted (23-JUN-2008) to the INSDC.
RL   Krause J., Evolutionary Genetics, Max Planck Institute, Deutscher Platz 6,
RL   04103 Leipzig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-220.
RX   PUBMED; 18662376.
RA   Krause J., Unger T., Nocon A., Malaspinas A.S., Kolokotronis S.O.,
RA   Stiller M., Soibelzon L., Spriggs H., Dear P.H., Briggs A.W., Bray S.C.E.,
RA   O'Brien S.J., Rabeder G., Matheus P., Cooper A., Slatkin M., Paabo S.,
RA   Hofreiter M.;
RT   "Mitochondrial genomes reveal an explosive radiation of extinct and extant
RT   bears near the Miocene-Pliocene boundary";
RL   BMC Evol. Biol. 8:220-220(2008).
XX
DR   MD5; 9f1f6a4497fe36789d6790ef9141c211.
DR   EuropePMC; PMC2518930; 18662376.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16752
FT                   /organism="Tremarctos ornatus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9638"
FT   D-loop          join(1..847,16301..16752)
FT   repeat_region   216..515
FT                   /rpt_type=TANDEM
FT                   /note="microsatellite"
FT   tRNA            848..915
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT   rRNA            916..1890
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   tRNA            1891..1956
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT   rRNA            1957..3535
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            3536..3610
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             3613..4568
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:4567..4568,aa:TERM)
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QWA9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWA9"
FT                   /protein_id="CAQ68469.1"
FT                   /translation="MFVINIISLIVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGL
FT                   LQPIADAVKLFTKEPLRPLTSSVTMFIMAPILALTLALTMWIPLPMPYPLINMNLGVLF
FT                   MLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLS
FT                   TLIITQEHLWLIFPMWPLAMMWFVSTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAL
FT                   FFLAEYANIIMMNALTTILFFGAFHNPYMPELYTVNFTAKTLLLTISFLWIRASYPRFR
FT                   YDQLMHLLWKNFLPLTLALCMWYVTLPIITASIPPQT"
FT   tRNA            4569..4637
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            complement(4635..4707)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            4709..4777
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT   CDS             4778..5819
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:5819,aa:TERM)
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8L1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8L1"
FT                   /protein_id="CAQ68470.1"
FT                   /translation="MNPPILTIIMSTIALGTMIVLFSSHWFMIWIGFEMNMLAIIPILM
FT                   KKFNPRAVEASTKYFLTQATASMLLMLGIIINLLYSGHWTISTTLNPIASTVITIALAM
FT                   KLGLSPFHFWVPEVTQGIPLSSGVILLTWQKIAPLSVLYQISPFINPNLLMTMAIASVL
FT                   LGGWGGLNQTQLRKILAYSSITHMGWMAAIMIYNPTLMILNLTIYIVMTLGTFMLFMHN
FT                   SSTTTLSLSHTWNKLPLITSLILALMLSLGGLPPLSGFIPKWMIIQELTKNDMIIMPVF
FT                   MAITALLNLYFYMRLAYATALTMFPSANNMKMKWQFETTKKMILLPPLIVASTMLLPLT
FT                   PILSTLD"
FT   tRNA            5820..5886
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT   tRNA            complement(5895..5963)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT   tRNA            complement(5964..6036)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(6070..6136)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT   tRNA            complement(6137..6202)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   CDS             6204..7748
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxI"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="GOA:A8QWB1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWB1"
FT                   /protein_id="CAQ68471.1"
FT                   /translation="MFMDRWLFSTNHKDIGTLYILFGAWAGMVGTALSLLIRAELGQPG
FT                   ALLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAIN
FT                   FITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMW
FT                   ALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL
FT                   FSGFTLNDTWAKIHFTIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYATWNTVSSMGS
FT                   FISLTAVMLMIFMIWEAFASKREVATIELTTTNIEWLHGCPPPYHTFEEPTYITLK"
FT   tRNA            complement(7746..7814)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            7821..7887
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT   CDS             7888..8571
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxII"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="GOA:A8QWB2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWB2"
FT                   /protein_id="CAQ68472.1"
FT                   /translation="MAYPFQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISTM
FT                   LTTKLTHTNTMDAQEVETVWTILPAIILVLIALPSLRILYMMDEINNPLLTVKTMGHQW
FT                   YWSYEYTDYEDLNFDSYMIPTQELKPGELRLLEVDNRAVLPMEMTIRMLISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPIVLELVPLSYFEKW
FT                   SASML"
FT   tRNA            8575..8641
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT   CDS             8644..8847
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="atp8"
FT                   /product="ATP synthase F0 subunit 8"
FT                   /db_xref="GOA:B5B8L4"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8L4"
FT                   /protein_id="CAQ68473.1"
FT                   /translation="MPQLDTSTWFITILSMTLTLFIVFQLKILKYNYPKTPELKPFPPS
FT                   KKTMPWEKKWTKIYLPLLLPQR"
FT   CDS             8805..9484
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:9483..9484,aa:TERM)
FT                   /gene="atp6"
FT                   /product="ATP synthase F0 subunit 6"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QWB4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWB4"
FT                   /protein_id="CAQ68474.1"
FT                   /translation="MNENLFASFTTPTMMGVPIVVLIIVFPSILFPSPSRLINNRLIST
FT                   QQWLVQLTLKQMLSIHNYKGQTWALMLMSLVLFIGSTNLLGLLPHSFTPTTQLSMNLGM
FT                   AIPLWAGTIVIGFRYKTKASLAHFLPQGTPFPLTPMLVVIETISLFIQPMALAVRLTAN
FT                   ITAGHLLIHLIGKATLALMNISIATALITFSILVLLTILELAVALIQAYVFALLVSLYL
FT                   HDNT"
FT   CDS             9485..10268
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10268,aa:TERM)
FT                   /gene="coxIII"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:A8QWB5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWB5"
FT                   /protein_id="CAQ68475.1"
FT                   /translation="MAHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSTSLLLL
FT                   GLTTNMLTMYQWWRDIIRESTFQGHHTPVVQKGLRYGMVLFIVSEVFFFTGFFWAFYHS
FT                   SLAPTPELGACWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHVLQAL
FT                   LITISLGVYFTLLQASEYYEASFTISDGIYGSTFFVATGFHGLHVIIGSTFLIICFLRQ
FT                   LHFHFTSSHHFGFEAAAWYWHFVDIVWLFLYVSIYWWGS"
FT   tRNA            10269..10337
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT   CDS             10338..10684
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10683..10684,aa:TERM)
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8L7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8L7"
FT                   /protein_id="CAQ68476.1"
FT                   /translation="MNLILALFTNALLSSLLILIAFWLPQLNIYAEKASPYECGFDPVG
FT                   SARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQANNLTTVLATALLLISLLAASLAY
FT                   EWTEKGLEWAK"
FT   tRNA            10685..10754
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT   CDS             10755..11051
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:A8QWB7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:A8QWB7"
FT                   /protein_id="CAQ68477.1"
FT                   /translation="MSMVYINIFLAFIVSLTGLLIYRSHLMSSLLCLEGMMLSLFVMLT
FT                   VTILNNHFTLASMAPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC"
FT   CDS             11045..12422
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:12422,aa:TERM)
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8L9"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8L9"
FT                   /protein_id="CAQ68478.1"
FT                   /translation="MLKIILPTVMLVPLTWMSKPNMIWINTTTYSLLTSLISLMYLNQL
FT                   SDNSLNFSPLFFTDSLSAPLLVLTTWLLPLMLMASQSHLSKETLTRKKLYITMLVLLQL
FT                   FLIMTFSAMELILFYILFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLVGSLPLLIA
FT                   LLHTQNNLGSLNFLMMQYWIQPLPSSWSSIFLWLACMMAFMVKMPLYGLHLWLPKAHVE
FT                   APIAGSMVLAAVLLKLGGYGMMRITMLLNPLTNFMAYPFMMLSLWGMIMTSSICLRQAD
FT                   LKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSR
FT                   IMILARGLQTLLPLMAAWWLLASLTNLALPPTINLIGELFVVMASFSWSNATIILMGTN
FT                   IIITALYSLYMLITTQRGKYTDHVKNIKPSFTRENALMALHLLPLLLLSLNPKMILGPI
FT                   Y"
FT   tRNA            12423..12491
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT   tRNA            12492..12550
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            12551..12620
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             12621..14441
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:B5B8M0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8M0"
FT                   /protein_id="CAQ68479.1"
FT                   /translation="MNLFTSSVITALLMLTMPIILTSTSTYKDKSYPQYVKTTISYAFT
FT                   ISTIPMMMFIFSGQETVISNWHWVTIQTLKLTLSFKLDYFSMIFMPVALFVTWSIMEFS
FT                   MWYMHADPNINQFFKYLLTFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAILYNRIGDVGFIMAMAWFLLNTNAWDFQQIFMIEHKNFNTPLMGLLLAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFHPLMEHNKAIQTATLCLG
FT                   AMTTLFTAICALTQNDIKKIIAFSTSSQLGLMVVTIGINQPHLAFLHICTHAFFKAMLF
FT                   LCSGSIIHNLNNEQDIRKMGGLLKVLPFTSTALIIGTLALTGMPFLTGFYSKDLIIETA
FT                   NTSYTNAWALLTTLVATSMTAAYSTRIVFFALLGQPRFNPTITINENNPLLTNPIKRLL
FT                   LGSIFAGYLISHSITPMNVPQTTMPYYLKMAALAVTILGFILALELNLTARNLKFNYPL
FT                   SPFKFSNQLGYFPIIIHRFVPMMSLSMSQKAASTLLDATWLENVLPKSISYFQMKSSIT
FT                   VSNQKGLIKLYFLSFMITLLLSFLVLNFHE"
FT   CDS             complement(14425..14952)
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:B5B8M1"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8M1"
FT                   /protein_id="CAQ68480.1"
FT                   /translation="MVTYTVFILSVVFVMGFVGFSSKPSPVYGGLVLIVSGGVGCGIVL
FT                   SFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWISNKAVLGAFIAGLLSELLVV
FT                   CCVLKDDEVEIVFKFNGVGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVVVTGWSLLI
FT                   GVLVVMEVTRGN"
FT   tRNA            complement(14953..15021)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT   CDS             15026..16165
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B5B8M2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8M2"
FT                   /protein_id="CAQ68481.1"
FT                   /translation="MTNIRKTHPLAKIINNSFIDLPTPSNISAWWNFGSLLGVCLVLQI
FT                   LTGLFLAMHYTADTTMAFSSVAHICRDVNYGWVIRYMHANGASMFFICLFMHVGRGLYY
FT                   GSYLFSETWNIGIILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   IWGGFSVDKATLTRFFTFHFILPFIILALAAIHLLFLHESGSNNPSGIPSNSDKIPFHP
FT                   YYTFKDILGALLFALILMTLVLFSPDLLGDPDNYTPANPLSTPLHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIFSILVLAIIPLLHTSKQRGMMFRPLSQCLFWLLAADLLTLTWIGG
FT                   QPVEHPLVIIGQLASILYFTILLVLMPIAGIIENNLSKW"
FT   tRNA            16166..16235
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(16235..16300)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
XX
SQ   Sequence 16752 BP; 5245 A; 4333 C; 2581 G; 4593 T; 0 other;
     gatcacacat aactgtggtg tcatgcattt ggtatctttt aattttgggg gggagaactt        60
     gctatgactc agctatgacc gtaaaggtct cgtcgcagtc aattgatctg tagctggact       120
     tattcacttt gcatggatcg ggcagacatc tataaggtgt tattcagtca atggttacgg       180
     gacatacgat acgtagagat cacggacggc ggagtgcgtg tgcgtgcgca tgtgtacgca       240
     tgcgtacaca tgtgtgcgtg tgcgtacaca tgtgtgcgtg tgcgtacaca tgtgtgcgtg       300
     tgcgtacgca tgtgtgcgtg tgcgtacgca tgtgtgcgtg tgcgtacgca tgtgtacgca       360
     tgtgtgcgtg tgcgtacgca tgtgtacgca tgtgtgcgtg tgcgtacgca tgtgtacgca       420
     tgtgtgcgtg tgcgtacgca tgtgtacgca tgtgtgcgtg tgcgtacgca tgtgtacgca       480
     cgtgtacacg tgtgtgcgtg cgtgtacgcg cacgttctta gatattaact tagcttaatc       540
     aaacccccct taccccccat aacttcaaga agcctacgcg catttatgat tgccttgcca       600
     aaccccaaaa acaagactaa acgcacgtgc aaacatgaag ctatcgtacc caaaaatccc       660
     atgtgataag ctaaaattcc cagccaaacg atcattgaaa tcgcaggtgt gagactttaa       720
     attaagatct atctatagat aatttttttt ttctctgact ccctcctatt gatttttcca       780
     ttattatcgc tttataatta ttgattccca ccgaatcatc ccatacaaat cccaaaaaat       840
     caaccatgtt catgtagctt agtagcaaag cgagacactg aaaatgtcta gacgagttac       900
     attactccat aaacataaag gtttggtcct ggccttccta ttagctatta acaagattac       960
     acatgtaagt ctccgcgccc cggtgaaaat gccctttaaa tctcttagct gattcgaagg      1020
     agcgggtatc aagcacacct ctctttccct ggagaggtag ctcataacgc cttgctcagc      1080
     cacaccccca cgggatacag cagtgataaa aattaagcca tgaacgaaag ttcgactaag      1140
     ctatgttaat taatagggct ggtaaatttc gtgccagcca ccgcggccat acgattagcc      1200
     cgagttaata ggtccacggc gtaaggcgtg tgaaaggaaa aaccccacca ctaaagttaa      1260
     agactaacca agccgtaaaa agctgtcgat agcactaaaa taaactacga aagtgacttt      1320
     aatgccccca accacacgac agctaagatc caaactggga ttagataccc cactatgctt      1380
     agccttaaac acagataatt taccaaacaa aattattcgc cagagaacta ctagcaatcg      1440
     cttaaaactc aaaggacttg gcggtgcttt aaacccccta gaggagcctg ttctataacc      1500
     gataaacccc gataaacctc accacccctt gctaatccag tctatatacc gccatcttca      1560
     gcgaaccctt aaaaggaaaa aaagtaagca taattatctc acataaaaaa gttaggtcaa      1620
     ggtgtaacct atgggatggg aagaaatggg ctacattttc tactcaagaa tagtctacga      1680
     aaatttttat gaaactaaaa actaaaggcg gatttagtag taaactaaga atagagagct      1740
     tagttgaata gggcaatgaa gcacgcacac accgcccgtc accctcctca agtgacgcta      1800
     aatcaaacac aacctattga aactagacaa atcataagag gaggcaagtc gtaacaaggt      1860
     aagcgtactg gaaagtgtgc ttggataaac caaagtgtag cttaaacaaa gcatctggct      1920
     tacacccagg agatttcaca cacatgacca ctttgaaccc agagctagcc cgaacgacaa      1980
     ccaattaaac tatcacaaac caatcagata aaacattcag caacacaatt aaagtatagg      2040
     agatagaaat tcttttaacc ggagctatag agaaagtacc gcaagggaac gatgaaagat      2100
     tacttaaagg aataaacagc aaagattact tcttttacct tttgcataat gagttagcta      2160
     gaaacaactt agcaaagaga acttaagcta agccccccga aaccagacga gctacctatg      2220
     aacaatccac tgggatgaac tcatctatgt cgcaaaatag tgagaagatt cataggtaga      2280
     ggtgaaaagc ctaacgagcc tggtgatagc tggttgccca gaatagaatt ttagttcaac      2340
     tttaaatttg cctataaacc taaaaatttt aatgcaagtt taaaatatat tctaaaaagg      2400
     tacagctttt tagaactaag gatacagcct tgcttagaga gtaaatatta atcaaaccat      2460
     agtaggctta gaagcagcca tcaattaaga aagcgttcaa gctcaacatc cacattaact      2520
     taataccaaa aatatataat caactcctaa cacgataact gggccaatct attcaaatat      2580
     agaagcaata atgctaatat gagtaacaag aaatacttct ccaatgcata agcctatagc      2640
     agcagcggat aaccactgat agttaacaac gatatagaaa taatttaaca ataaaacatc      2700
     tattaaacca attgttaatc caacacaggt atgcaattaa ggaaagatta aaagaagtaa      2760
     aaggaactcg gcaaacacaa accccgcctg tttaccaaaa acatcacctc cagcatttct      2820
     agtattggag gcactgcctg cccggtgaca ttagttaaac ggccgcggta tcctgaccgt      2880
     gcaaaggtag cataatcatt tgttctctaa ataaggactt gtatgaacgg ccacacgagg      2940
     gtttaactgt ctcttacttc caatcggtga aattgacctt cccgtgaaga ggcgggaatg      3000
     aaataataag acgagaagac cctatggagc tttaattaat taactcaaaa gaatctatac      3060
     actaaaccaa taggaacaat acatttctct tatgagttaa caatttgggt tggggcgacc      3120
     tcggagtata aaacaacctc cgagtgatac aaatctagac ataccagtca aaatgcttac      3180
     tcacttattg atccaaaact tctttgatca acggaacaag ttaccctagg gataacagcg      3240
     caatcctatc cgagagtcca tatcgacaat agggtttacg acctcgatgt tggatcagga      3300
     catcccaatg gtgcagcagc tattaaaggt tcgtttgttc aacgattaaa gtcctacgtg      3360
     atctgagttc agaccggagc aatccaggtc ggtttctatc tatttaaatg atttctccca      3420
     gtacgaaagg acaagagaaa tgaggcccac tttaccgaag cgccttaaga ccaatagatg      3480
     atttaatcta aatctagtaa gtctactccc aatatcgccc aagaaacagg gctttgttag      3540
     ggtggcagag tccggtaatt gcgtaaaact taaactttta tatccaaagg ttcaaatcct      3600
     ctccctaaca ttatgtttgt aattaacatt atctcactaa tcgtaccaat ccttcttgcc      3660
     gtagccttcc taacactagt agaacggaag gtactaggct acatacaact tcgaaaagga      3720
     ccaaacattg taggacccta cggcctccta caacccatcg cagacgccgt aaaactcttc      3780
     accaaggagc ccttacggcc actcacatcg tctgtaacta tatttatcat agcccctatt      3840
     ctagccctaa cactagccct gaccatatga attcccctac caataccata ccccctcatc      3900
     aacataaacc taggagtact attcatacta gcaatatcaa gcctagctgt gtattctatt      3960
     ctctggtctg gatgagcctc aaactcaaaa tacgccctaa ttggagcctt acgagccgta      4020
     gcccaaacaa tctcatatga agtcacacta gccattattc tcctatcggt cctactaata      4080
     aatggctcgt ttacactttc cacactaatc atcactcagg aacatctctg actaatcttc      4140
     cccatgtgac ccctagccat aatatgattt gtctctactt tagcagaaac caatcgagct      4200
     cccttcgacc taacagaagg agaatcagag ctagtctcag gatttaacgt cgaatacgca      4260
     gcaggcccat ttgctctatt tttcctggca gaatatgcca acatcattat aataaatgcc      4320
     ctcacaacta tcctattctt tggagcattc cataacccct acatgccaga actatatacc      4380
     gtcaacttca ctgcaaaaac actactccta acaatctctt tcctatggat tcgcgcatca      4440
     tacccccgat ttcggtacga tcaactaata cacctattat gaaaaaactt tctacctctc      4500
     acattagcct tatgcatatg gtacgtaact ctacctatta ttacagcaag catccctccc      4560
     caaacataag aaatatgtct gacaaaagag ttactttgat agagtaaata atagaggttt      4620
     aaatcctctt atttctagaa ttataggaat cgaacctaat cttaagaatc caaaaatctt      4680
     cgtgctacct gattacacca catcctagag taaggtcagc taaataagct atcgggccca      4740
     taccccgaaa atgttggttt atccccttcc catactaata aatcctccca ttcttactat      4800
     tattatatcc accatcgctc taggaaccat aatcgttcta tttagctccc actgatttat      4860
     aatctgaatc ggttttgaaa taaatatact ggcaattatt cccattttaa tgaaaaaatt      4920
     taacccacga gccgtagaag cctccacaaa atattttcta acacaggcca ctgcatccat      4980
     gctcctcata ctaggcatta ttatcaactt actatactca ggacactgaa caatctcaac      5040
     aactctcaac ccaatcgcat caaccgtgat caccattgcc ctagcgataa aacttggcct      5100
     atctcccttc cacttctgag ttccagaagt tacacaaggc attcccctat cctcaggagt      5160
     aatcctacta acatgacaga aaatcgcacc cttgtccgtt ctataccaga tctcaccatt      5220
     cattaaccca aacttattaa taacaatggc tatcgcatcc gtactactag gaggctgagg      5280
     aggactaaac caaactcaac tccgaaaaat cctagcatac tcctcaatca ctcacatagg      5340
     ctggatagct gccatcataa tctataatcc tactctaata attcttaacc taacaatcta      5400
     catcgtaata accctaggaa cgttcatatt attcatgcat aactcatcca cgacgacact      5460
     atcactatcc cacacatgaa ataaactccc actaatcacc tcgctaatcc tagcacttat      5520
     actatcacta ggaggcctcc ctcccctctc aggctttatt cccaagtgaa taatcattca      5580
     agaactaaca aaaaatgata taatcattat acctgtattc atagccatca cagccctact      5640
     aaacctatat ttctacatac gcctagcata cgccacagca ctaacaatat tcccttcagc      5700
     aaataacata aaaatgaaat gacaattcga gaccacaaaa aagataatcc tcctaccccc      5760
     tctgattgta gcatcaacta tactcctccc actaactcca attctatcaa ccctggacta      5820
     gagatttagg ctaaacagac caagggcctt caaagcccta agtaagtgaa actcacttaa      5880
     tctctgcaac catctaagga ctgcaagagt acacctcaca tcaattgaat gcaaaacaat      5940
     cgctttaatt aagctaagcc cttctagatc ggcgggcttt tatcccacaa aactttagtt      6000
     aacagctaaa aaccctaaac aactggattc aatctacttc tcccgccgcg taggaaaaaa      6060
     aggcgggaga agccccggca gaattgaatc tgcttctttg aatttgcaat tcaatatgat      6120
     tactcaccac agggcctggt aaaagaggac ttaaccccca tatttagatt tacagtctaa      6180
     tgcttttatc agccatttta cctatgttca tagaccgatg actattttcc acaaaccata      6240
     aagacattgg tactctctat atcttattcg gtgcatgagc cggaatagta ggtactgccc      6300
     tcagccttct aatccgcgct gaactaggtc aacccggagc cctgttaggg gatgatcaaa      6360
     tctataacgt ggtcgtaact gcccatgcat tcgtaataat cttctttata gtaatgccta      6420
     ttataatcgg aggttttgga aactgattag tgcctttaat aattggcgct cccgatatag      6480
     cattccctcg aataaacaat atgagtttct gattactgcc accatccttc ctacttcttc      6540
     tagcctcttc catagtagaa gcaggtgcag ggactggttg aactgtctac ccccctctag      6600
     cgggcaatct agcccatgca ggagcatcag tagacctaac aattttttcc ctacatttag      6660
     caggcgtttc ctccattcta ggagctatta actttattac cactattatc aatatgaagc      6720
     ctcctgcaat atctcaatac caaactcctc tgttcgtatg atccgttcta attacggcgg      6780
     tacttcttct cttatcctta ccagttctgg cagctgggat tactatgctg ctgacagatc      6840
     gaaacctcaa cactactttc tttgatccgg caggaggagg ggaccccatt ctgtaccaac      6900
     acttgttctg attctttggg cacccagagg tatatatcct aattcttcct ggattcggga      6960
     taatctcaca catcgtcacg tactattcag ggaaaaaaga accctttggt tatataggga      7020
     tggtttgagc aatgatatcc atcggattct taggtttcat cgtatgagcc catcacatat      7080
     tcactgtagg catggatgtt gatacacgag cctacttcac ctcagcaacc atgattattg      7140
     caatcccaac gggagttaaa gtatttagct gactggctac cctgcatgga ggaaacatta      7200
     aatgatcccc cgctataata tgagccttag gctttatctt tctatttaca gtgggaggtc      7260
     tcacaggaat tgtcttggcc aactcgtccc tggatattgt tcttcatgat acatactacg      7320
     tagtagccca ctttcactat gtactatcaa taggagccgt ctttgccatc atgggtggat      7380
     ttgtccactg atttccacta ttttcaggct tcacactcaa tgatacatga gcaaaaatcc      7440
     actttacaat catgtttgtt ggggttaata tgacgttctt tccccaacac ttcctaggcc      7500
     tatcaggaat gcctcgacga tactccgatt acccagatgc ctatgcaaca tgaaatacag      7560
     tatcttctat aggctcattc atttcactaa cagcggttat gctaataatt ttcataattt      7620
     gggaagcctt cgcatcgaaa cgagaagtgg caacaattga actcaccaca acgaatatcg      7680
     aatgactaca cggatgccct cctccgtatc acacattcga ggaacccact tacatcacac      7740
     taaaataaga aaggaaggag tcgaaccccc tgaaattggt ttcaagccaa taccataacc      7800
     actatgtctc tcttaataaa gagatattag taaaaattac ataacttcgt cagggttaaa      7860
     ttataggtga aaatccttta tatctctatg gcgtatccct ttcaaatagg ccttcaagac      7920
     gcaacttctc ccattataga agagctccta cacttccacg accatacatt aatgattgta      7980
     ttcctgatta gctccttagt tctctacatt atttcaacta tgctaactac taaactaacg      8040
     cacacaaaca caatagatgc acaggaagta gaaacggtat gaaccattct accagccatt      8100
     atcctggttc taattgcact cccatcatta cgaatcctct atataatgga tgaaatcaac      8160
     aatcctttac tgactgtaaa aactataggc catcaatgat actgaagtta cgaatatacg      8220
     gactatgagg atttgaactt tgattcttac atgattccaa cacaagaatt aaagcctgga      8280
     gaactacgac tattagaagt agacaatcga gcggtactac ccatagaaat gactattcgc      8340
     atgctaattt catcagaaga tgtcttgcac tcatgagctg taccatccct aggactaaaa      8400
     actgatgcaa ttccgggacg actaaaccaa acgactctca tggccatgcg accagggctg      8460
     tattatggcc aatgctcgga aatctgtggc tctaaccaca gcttcatgcc tattgttctc      8520
     gaactagtcc cactgtccta tttcgaaaaa tgatccgctt caatattata aaatcattaa      8580
     gaagctatat agcattaacc ttttaagtta aagactgaga gtgcaagtct ctccttaatg      8640
     gagatgccac aactagacac gtcaacatgg tttatcacaa ttctatctat aactctaaca      8700
     ctatttattg tattccaact aaaaatccta aagtacaatt accccaaaac tcccgaacta      8760
     aaaccttttc caccatcaaa aaaaactata ccttgagaaa agaaatgaac gaaaatttat      8820
     ttgcctcttt tactacccca acgataatag gagtccctat tgtagtccta atcattgtat      8880
     tcccaagtat tctatttcca tcccctagtc gactgattaa taaccgtttg atttctaccc      8940
     aacagtgatt agttcagcta acattaaaac aaatactgtc tattcacaat tacaagggac      9000
     aaacctgagc actgatatta atatcactgg tcttatttat cggctcaacc aaccttctag      9060
     gcctactgcc acactcattt acgcctacta cacaactatc aataaattta ggaatggcta      9120
     tccccttatg agcgggtaca atcgttatcg gattccgata taaaaccaaa gcatccctag      9180
     ctcacttctt acctcaagga acaccctttc ccctaactcc aatactagta gttatcgaaa      9240
     caatcagtct attcatccaa cctatggcct tagctgtgcg tctaactgcc aacatcactg      9300
     caggtcactt acttattcat ctaattggaa aagctactct agctctaata aacatcagca      9360
     tcgccacagc cctcatcact ttctctattc tagtactact cactattctt gaactcgccg      9420
     tggctctcat ccaagcctat gtctttgctc tactagtaag tctatactta catgacaaca      9480
     cctaatggcc caccaaacac atgcatatca catagtcaat ccaagcccat gaccactaac      9540
     gggagccctt tcagcccttc ttataacatc aggactaatc atatgattcc acttcaactc      9600
     aacatccttg ctattactag gccttacaac taatatactt accatatatc aatgatgacg      9660
     ggacattatc cgagaaagta cttttcaagg ccaccacact cctgtcgttc aaaaggggtt      9720
     gcggtatggg atagtcctat ttattgtatc ggaggtattt ttcttcacag gattcttctg      9780
     agctttttac cactcaagtc tagcacctac tcccgaacta ggagcatgct gaccacccac      9840
     aggcatcacc cccctaaacc cattggaagt gccgcttctt aatacctcag tactcctagc      9900
     atctggagta tctattactt gagcccacca tagcttaata gaaggaaatc gcaatcatgt      9960
     actccaggct ctacttatca ctatctcctt aggtgtatac tttacactcc tacaggcctc     10020
     agaatattac gaagcatctt ttaccatttc ggacggaatc tatggctcaa ccttcttcgt     10080
     agcaactggg ttccatggac tccacgtaat tattggctca accttcctca ttatctgctt     10140
     cctacgacaa ctacacttcc attttacatc aagccaccac tttggcttcg aagcagcagc     10200
     atggtattga cacttcgtag atatcgtatg actattctta tatgtctcta tctattgatg     10260
     aggatcctgc ctctttagta ttaatcagta caattgactt ccaatcaatt agttctggta     10320
     cagtccagaa agaagcaatt aacctaattc tagcactatt tactaacgca ctactgtcct     10380
     ctttactcat tcttatcgca ttctggttac cacaattaaa catctacgcg gagaaagcaa     10440
     gtccttatga gtgcggattt gatcccgtgg gatcggcacg cctccccttt tccataaaat     10500
     tttttctggt agctatcaca tttctattat ttgacctgga aatcgcacta cttctccctc     10560
     taccctgagc gttgcaagcc aacaacctaa caactgtact tgctacagca ctactgctca     10620
     tctctctact agctgcaagc ctagcctatg aatgaactga aaagggacta gaatgggcta     10680
     aatatgataa ttagtttaag tcaaaaacaa atgatttcga ctcattaaat tatgaataat     10740
     atcataatta tcaaatgtcc atagtctaca ttaatatctt cttggctttt attgtatccc     10800
     taacaggact actcatctac cgatcccacc taatgtcttc cctactctgc ttggaaggta     10860
     taatattgtc tctatttgtc atactaacag taacaatcct aaacaaccat ttcacactag     10920
     ctagcatagc cccgatcatc ctactagtat tcgctgcctg cgaagcagca ctggggctat     10980
     ccctactagt aatggtctcc aatacctatg gaactgacta tgtacaaaac cttaacctcc     11040
     tacaatgcta aaaattatcc ttcccactgt aatgctggta cctcttacgt gaatatcaaa     11100
     acccaatata atctgaatca acacgacaac ttacagtcta ctcactagcc ttattagcct     11160
     aatatacctt aatcaactta gcgataacag cctgaacttc tcaccactat tcttcaccga     11220
     ttccctatca gcccccctat tagttctcac aacatggcta ctccctctaa tgttaatggc     11280
     cagtcaatcc cacctgtcaa aggagactct gactcgaaag aaattataca ttaccatact     11340
     agttctccta caactgttcc taatcataac attttccgcc atagaactaa tcctatttta     11400
     tatcctattc gaggccaccc tagtacctac cttaatcatc atcacccgat gagggaatca     11460
     aacagaacgg ttaaatgcgg gcctttactt tctattctac accctagtag gatctttacc     11520
     cctactaatt gcactattac atacccaaaa caacctaggc tccttaaact ttctcatgat     11580
     gcaatactga attcaaccct taccaagctc ctgatctagt atcttcttat gactagcatg     11640
     catgatagca ttcatggtaa aaatacccct atatggcctc catctatgac taccaaaggc     11700
     acacgtagaa gctcctatcg caggatccat agtacttgcc gccgtacttc taaaactagg     11760
     aggctacggt atgatgcgaa tcacaatact gctcaacccc ttaacaaact ttatggccta     11820
     ccccttcatg atactctcgc tgtgaggcat gatcatgaca agttccattt gtctacgcca     11880
     agcagacctg aaatccctaa tcgcctactc ttccgtcagt catatagccc tagtaattgt     11940
     agcagtatta attcaaaccc catggagcta catgggagcg acggctttga tgatcgccca     12000
     tggactaaca tcctctatac tattctgcct tgcaaactcc aactacgagc gaacccatag     12060
     tcgaatcata atccttgcac gaggtctaca aacacttctc ccacttatag cagcttgatg     12120
     acttctagca agcctcacta acctggcact tcctcctacc attaacctca ttggggaatt     12180
     attcgtagta atagcctcat tttcatgatc caacgctact attattctaa taggaaccaa     12240
     catcatcatt actgccctct actccctcta catgctaatt accacacaac gaggtaaata     12300
     cacagaccac gttaaaaaca tcaagccatc cttcacacga gaaaacgccc taatagccct     12360
     tcacttatta cccctcctac tgctatctct caaccctaaa atgattctag gacccattta     12420
     ttgtaaatat agtttaacta aaacattaga ttgtgaatct agtaataaaa gctcaaatct     12480
     ttttatttac cgaaaaagta tgcaagaact gctaactcat gcgcccatgc ataaaatcat     12540
     ggctttttca acttttaaag gatagaagta atccattggt cttaggaacc aaaaaattgg     12600
     tgcaactcca aataaaagta atcaatctat ttacctcctc cgttattaca gccctactca     12660
     tgctaacaat accaattatc ctaaccagta cttcaacata taaagataaa tcctacccac     12720
     agtacgtaaa gaccacaatt tcttacgcct ttacaatcag cactatcccc ataataatat     12780
     tcatcttctc aggacaagaa acggtcatct cgaactgaca ctgagtgaca attcaaactc     12840
     taaaattaac tctcagcttt aagctagact acttctcaat gattttcatg ccagtagctc     12900
     tgtttgttac atgatcaatc atagaattct ccatgtgata tatacatgcc gaccccaaca     12960
     ttaaccaatt ctttaagtat ctccttacgt tccttattac cataatgatc ttagtgaccg     13020
     caaacaacct attccaacta tttattggct gagaaggagt aggaattata tctttcctcc     13080
     tcattgggtg gtgatatggc cgaacagacg ctaatacggc cgccctacaa gcgattctat     13140
     acaaccgcat cggggacgtg ggctttatca tggctatagc ttgatttcta ctcaatacaa     13200
     atgcgtgaga cttccaacaa atctttataa tcgaacataa aaacttcaac actccactga     13260
     taggtctact tttagcagct accggaaaat cggcccaatt cggcctccat ccatgacttc     13320
     catcagccat agaaggaccc actcccgttt cagccctact ccactccagt acaatggtag     13380
     tggcaggggt attcctccta attcgattcc accccctaat ggaacataac aaggccatcc     13440
     aaacggctac tttatgcctg ggagcaataa caaccctatt cacagcaatc tgtgccctca     13500
     cccaaaacga tatcaaaaaa atcattgcct tctccacctc aagccaattg ggattaatag     13560
     tcgtaacaat cggaatcaac cagccccatc tagcattcct ccatatctgt acacacgcat     13620
     tcttcaaagc catactgttc ttatgctccg gatccatcat ccataaccta aataacgagc     13680
     aagatatccg aaagatagga ggcctgctca aagtcctgcc attcacttcc actgcactga     13740
     tcatcggaac tctagctctt acaggaatgc ctttccttac ggggttctac tctaaagacc     13800
     taattattga aaccgccaac acgtcgtata ccaacgcctg agccctatta acaaccctcg     13860
     ttgccacatc cataaccgct gcctatagta ctcgaattgt attctttgca cttttaggac     13920
     aaccccgctt taaccctact atcaccatta acgaaaataa ccccctttta accaacccta     13980
     ttaaacgcct actattggga agtatcttcg caggatattt aatctcccac agcatcacac     14040
     ctataaatgt cccacaaaca accataccct attacctaaa aatggcagcc cttgcagtga     14100
     ccatcttagg ctttatccta gcgctagaac tcaacctcac tgcacgaaac ctcaaattca     14160
     actatccact aagcccattc aaattttcca accaactggg atatttccct attattattc     14220
     atcgcttcgt accaataatg agcttatcaa taagccaaaa agcagcgtcc acactgttag     14280
     acgcaacctg actggaaaat gtattgccaa aatccatctc ctactttcaa ataaaatcct     14340
     caattacagt ctccaaccaa aaaggactga tcaaactata ctttctctcc tttataatta     14400
     cactcctcct aagcttcctc gtgcttaatt tccacgagta acttccataa ctaccaacac     14460
     cccgatgaga agagaccatc cagtaacgac aactagccaa gtcccatagc tatataatgc     14520
     tgcaatcccc atggcctcct cactaaaaaa tccagagtct cccgtatcat aaattactca     14580
     gtcacccacc ccattaaact taaatacaat ttcgacctca tcatccttta aaacacaaca     14640
     aacaaccaac aactcggaca ataatcccgc aataaatgca cccaatacag ccttattaga     14700
     aattcaaact tcaggatact gctcggtagc catagccgta gtataaccaa aaactacaag     14760
     tattccacct agataaatta aaaaaaccat caaacctaaa aaagaccccc cgaaacttag     14820
     tacgatacca catccaacac ccccactaac aattaaaact aaacccccgt aaacaggaga     14880
     gggcttagaa gaaaagccta caaaacctat tacaaaaaca acacttaaaa tgaacacagt     14940
     atatgttacc attattccca catggaatct aaccatgact aatgacatga aaaatcaccg     15000
     ttgtatttca actataagaa tcttaatgac caacatccga aaaactcacc cactagctaa     15060
     aatcatcaac aactcattca tcgacctccc aacaccatca aatatctcag catgatgaaa     15120
     cttcgggtcc cttcttgggg tgtgcctggt cctacaaatc ctaacgggcc tattcctggc     15180
     catacactat acagcagaca cgactatagc cttctcatca gtcgcccata tctgtcgaga     15240
     cgttaactac ggatgagtta tccgatatat acacgcgaac ggggcttcaa tattctttat     15300
     ctgcttattc atacacgtgg gacggggtct gtactacggc tcatacctat tttcagaaac     15360
     atgaaacatt ggaattattc tcctactcac agttatagcc acagcattca tggggtacgt     15420
     cctgccctga ggccaaatat ccttttgagg agcaaccgtc atcaccaatc tgctatcagc     15480
     tatcccctac attggaaccg acctagtaga atgaatctga gggggctttt ctgtagacaa     15540
     agcgacccta acacgatttt ttaccttcca ctttatcctt ccattcatca tcctagcgct     15600
     agcagcaatt cacctactat ttctacacga atcaggatcc aataatccct ccggaattcc     15660
     atccaactcg gacaaaatcc catttcaccc gtactacaca ttcaaagata tcttaggtgc     15720
     cctactcttc gccttaatcc taataacttt agttctattt tcacctgacc tattaggaga     15780
     ccccgacaac tacacccccg caaacccact gagcacccca ctacatatca agcctgaatg     15840
     atacttctta tttgcctacg ccattctacg atctattccc aataaattgg gaggagtact     15900
     ggccctaatc ttctccattc tagtcctagc tatcattcct ctgctgcaca catccaaaca     15960
     acgaggaatg atattccgac ctttaagcca atgccttttc tggcttctag cagcagactt     16020
     actaacacta acatgaatcg gaggacaacc agtggaacat cctcttgtta tcatcggaca     16080
     gctagcctct atcctctact tcacaatcct cctagtactt atacccatcg ccggaatcat     16140
     tgaaaacaac ctctcaaagt gaagagtctt tgtagtataa taattacctt ggtcttgtaa     16200
     gccaaaaatg gagaacactc accctcccca agactcaagg aagaaacaat agctccacca     16260
     tcaacaccca aagctgacat tctatttaaa ctattccctg atactactat ttcacccaac     16320
     attttactta tttcatatat atcatcccac gtactgtagc atcctagtat gtccccgaac     16380
     aaggaaacct ttcttttttt ttccccccta tgtacgtcgt gcattaatgg cgtgccccat     16440
     gcatataagc atgtacatat cttgcttggt tttacatgag gacatggact tcaaaaactc     16500
     gttctgaaga cgtagtctgc aagcatgtat ttcacttagt ccgggagctt agtcaccagg     16560
     cctcgagaaa ccagcaaccc ttgcgagtac gtatacctct tctcgctccg ggcccataga     16620
     aacgtggggg tttctatact gaaactatac ctggcatctg gttcttactt cagggccatg     16680
     atagctctag attccaatcc tactaaccct tcaaatggga catctcgatg gactaatgac     16740
     taatcagccc at                                                         16752
//