spacer

EBI Dbfetch

ID   FM177762; SV 1; circular; genomic DNA; STD; MAM; 16754 BP.
XX
AC   FM177762;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Arctodus simus complete mitochondrial genome
XX
KW   complete genome.
XX
OS   Arctodus simus (giant short-faced bear)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Arctodus.
OG   Mitochondrion
XX
RN   [1]
RP   1-16754
RA   Krause J.;
RT   ;
RL   Submitted (23-JUN-2008) to the INSDC.
RL   Krause J., Evolutionary Genetics, Max Planck Institute, Deutscher Platz 6,
RL   04103 Leipzig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-220.
RX   PUBMED; 18662376.
RA   Krause J., Unger T., Nocon A., Malaspinas A.S., Kolokotronis S.O.,
RA   Stiller M., Soibelzon L., Spriggs H., Dear P.H., Briggs A.W., Bray S.C.E.,
RA   O'Brien S.J., Rabeder G., Matheus P., Cooper A., Slatkin M., Paabo S.,
RA   Hofreiter M.;
RT   "Mitochondrial genomes reveal an explosive radiation of extinct and extant
RT   bears near the Miocene-Pliocene boundary";
RL   BMC Evol. Biol. 8:220-220(2008).
XX
DR   MD5; 1c7a6b516dadee6d5778d3f10d03a2e4.
DR   EuropePMC; PMC2518930; 18662376.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16754
FT                   /organism="Arctodus simus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada"
FT                   /db_xref="taxon:551196"
FT   D-loop          join(1..845,16394..16754)
FT   gap             152..544
FT                   /estimated_length=393
FT   tRNA            846..913
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT   rRNA            914..1890
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   tRNA            1891..1956
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT   rRNA            1957..3535
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            3536..3610
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             3613..4567
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:4567,aa:TERM)
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8I4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I4"
FT                   /protein_id="CAQ68443.1"
FT                   /translation="MFMINIISLIVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGL
FT                   LQPVADAVKLFTKEPLRPLTSSVTMFIMAPILALTLALTMWIPLPMPYPLINMNLGVLF
FT                   MLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLS
FT                   TLIITQEHLWLIFPAWPLAMMWFVSTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAL
FT                   FFLAEYANIIMMNALTTILFFGAFHNPYMPELYTANFTMKTLLLTTSFLWIRASYPRFR
FT                   YDQLMHLLWKNFLPLTLALCMWYTTLPIITASIPPQT"
FT   tRNA            4569..4637
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            complement(4635..4707)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            4709..4777
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT   CDS             4778..5819
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:5819,aa:TERM)
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8I5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I5"
FT                   /protein_id="CAQ68444.1"
FT                   /translation="MKPPILIIIMSTIALGTMIVLFSSHWFMIWIGFEMNMLAIIPILM
FT                   KKHNPRAVEASTKYFLTQATASMLLMLGIIINLLYSGHWTISTILNPIASTTITIALAM
FT                   KLGLSPFHFWVPEVTQGIPLSSGLILLTWQKIAPLSILHQISPSINPNLLMAMATASVL
FT                   MGGWGGLNQTQLRKILAYSSIAHMGWMAAIMIYNPTLMILNLMIYITMTLGTFMLFMHN
FT                   LSTTTLSLSHTWNKFPLITSLILALMLSLGGLPPLSGFIPKWMIIQELTKNDMIIMPMF
FT                   MAITALLNLYFYMRLAYATALTMFPSANNMKMKWQFEATKKVILLPPLIVASTMLLPLT
FT                   PMLSTLD"
FT   tRNA            5820..5886
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT   tRNA            complement(5895..5963)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT   tRNA            complement(5964..6036)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(6070..6136)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT   tRNA            complement(6137..6202)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   CDS             6204..7748
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxI"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="GOA:B5B8I6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I6"
FT                   /protein_id="CAQ68445.1"
FT                   /translation="MFMNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPG
FT                   ALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAIN
FT                   FITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMW
FT                   ALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL
FT                   FSGFMLNDTWAKIHFTIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYATWNTVSSMGS
FT                   FISLTAVMLMIFMIWEAFASKREVGTVELTTTNIEWLHGCPPPYHTFEEPTYITLK"
FT   tRNA            complement(7746..7814)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            7821..7887
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT   CDS             7888..8571
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxII"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="GOA:B5B8I7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I7"
FT                   /protein_id="CAQ68446.1"
FT                   /translation="MAYPFQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISTM
FT                   LTTKLTHTSTMDAQEVETVWTILPAIILILIALPSLRILYMMDEINNPLLTVKTMGHQW
FT                   YWSYEYTDYEDLSFDSYMIPTQELKPGELRLLEVDNRVVLPMEVTVRMLISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPVVLELVPLSYFEKW
FT                   SASML"
FT   tRNA            8575..8641
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT   CDS             8644..8847
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="atp8"
FT                   /product="ATP synthase F0 subunit 8"
FT                   /db_xref="GOA:B5B8I8"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I8"
FT                   /protein_id="CAQ68447.1"
FT                   /translation="MPQLDTSTWFITTLSMVLALFIVFQLKILKYNYSETPGLKSSLSL
FT                   KKTMPWEKKWTKIYLPLLLPQQ"
FT   CDS             8805..9483
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:9483,aa:TERM)
FT                   /gene="atp6"
FT                   /product="ATP synthase F0 subunit 6"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8I9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8I9"
FT                   /protein_id="CAQ68448.1"
FT                   /translation="MNENLFASFITPTMMGVPIVVLIVVFPSILFPSPSRLINNRLVSI
FT                   QQWLVQLTSKQMLSIHNHKGQAWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGM
FT                   AIPLWAGTIVIGFRYKTKASLAHLLPQGTPFPLIPMLVIIETISLFIQPMALAVRLTAN
FT                   ITAGHLLIHLIGGATLALTNISVATALITFTVLVLLTILEFAVALIQAYVFTLLVSLYL
FT                   HDNT"
FT   CDS             9485..10268
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10268,aa:TERM)
FT                   /gene="coxIII"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8J0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J0"
FT                   /protein_id="CAQ68449.1"
FT                   /translation="MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSMSLLLL
FT                   GLTTNMLTMYQWWRDIIRESTFQGHHTPVVQKGLRYGMILFIVSEVFFFTGFFWAFYHS
FT                   SLAPTPELGACWPPTGIIPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHALQAL
FT                   LITISLGVYFTLLQASEYYEASFTISDGIYGSTFFVATGFHGLHVIIGSTFLIICFLRQ
FT                   LHFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
FT   tRNA            10269..10337
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT   CDS             10338..10684
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10683..10684,aa:TERM)
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8J1"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J1"
FT                   /protein_id="CAQ68450.1"
FT                   /translation="MNLILALFTNTLLASLLVLIAFWLPQLNIYAEKVSPYECGFDPMG
FT                   SARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQAKNPTTVLITALLLISLLAASLAY
FT                   EWTEKGLDWTE"
FT   tRNA            10685..10754
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT   CDS             10755..11051
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:B5B8J2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J2"
FT                   /protein_id="CAQ68451.1"
FT                   /translation="MSMVYINIFLAFIVSLMGLLIYRSHLMSSLLCLEGMMLSLFVMLA
FT                   VTVLNNHFTLASMTPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC"
FT   CDS             11045..12422
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:12422,aa:TERM)
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8J3"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J3"
FT                   /protein_id="CAQ68452.1"
FT                   /translation="MLKIILPTMMLMPLTWTSKPNMIWINTTTYSLLISLISLTYLNQL
FT                   SDNSLNFSLLFFTDSLSAPLLVLTTWLLPLMLMASQFHLSKETLTRKKLYITMLILLQL
FT                   FLIMTFSAMELILFYILFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLVGSLPLLIA
FT                   LLHTQNNLGSLNFLMMQYWTQPLPNSWSSIFLWLACMMAFMVKMPLYGLHLWLPKAHVE
FT                   APIAGSMVLAAVLLKLGGYGMMRITTLLSPLTNSMAYPFMMLSLWGMIMTSSICLRQAD
FT                   LKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSR
FT                   IMILARGLQTLLPLMAAWWLLASLTNLALPPTINLIGELFVVMASFSWSNTTIVLMGTN
FT                   IIITALYSLYMLITTQRGKYTDHIKNIKPSFTRENALMALHLLPLLLLSLNPKMILGPV
FT                   Y"
FT   tRNA            12423..12491
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT   tRNA            12492..12550
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            12551..12620
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             12621..14441
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:B5B8J4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J4"
FT                   /protein_id="CAQ68453.1"
FT                   /translation="MNLFTSSVITALLMLTMPIILTSTSVYKDKSYPQYVKTTISYAFM
FT                   VSTIPMMMFIFSGQETVISNWHWMTIQTLKLTLSFKLDYFSMIFMPVALFVTWSITEFS
FT                   MWYMHADPNINRFFKYLLMFLITMMTLVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAVLYNRIGDVGFIMAMAWFLLNTNAWDFQQIFMIGHKDLNTPLVGLLLAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFHPLMEHNKTIQTTTLCLG
FT                   AMTTLFTAICALTQNDIKKIIAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLF
FT                   MCSGSIIHNLNNEQDIRKMGGLFKVLPFTSTALIVGTLALTGMPFLTGFYSKDLIIETA
FT                   NTSYINAWALLTTLAATSMTAAYSTRIVFFALLGQPRFNPTVTINENNPLLINSIKRLL
FT                   LGSILAGYLISHSIAPMNIPQMTMPYYLKMTALAVTTLGFILALELNLTAQGLKFDYPL
FT                   NPFKFSIQLGYFPTIIHRSVPMMSLSMSQKAASMLLDAIWLENVLPKSISYFQMKSSTT
FT                   ISNQKGLIKLYFLSFMITLLLSFLVLNFHE"
FT   CDS             complement(14425..14952)
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:B5B8J5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J5"
FT                   /protein_id="CAQ68454.1"
FT                   /translation="MMTYIVFILSVVFVMGFVGFSSKPSPIYGGLVLIVSGGVGCGIVL
FT                   NFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWISNKAVLGAFIVGLLSELLVV
FT                   CYVLKDDEIEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLI
FT                   GVLVIVEVTRGN"
FT   tRNA            complement(14953..15021)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT   CDS             15026..16165
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B5B8J6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8J6"
FT                   /protein_id="CAQ68455.1"
FT                   /translation="MTNIRKTHPLAKIINNSFIDLPTPSNISAWWNFGSLLGVCLVLQI
FT                   LTGLFLAMHYTADTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYY
FT                   GSYLFSETWNIGIILLFTTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   IWGGFSVDKATLTRFFTFHFILPFIILALAAVHLLLLHETGSNNPSGIPSNSDKIPFHP
FT                   YYTIKDILGALFLILTLMTLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVFSILVLAIIPLLHTSKQRGMMFRPLSQCLFWLLTADLLTLTWIGG
FT                   QPVEYPFIIIGQLASILYFTILLVLMPVAGIIENNFSKW"
FT   tRNA            16166..16235
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(16235..16302)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
XX
SQ   Sequence 16754 BP; 5242 A; 4184 C; 2388 G; 4547 T; 393 other;
     gatcacacat aactgtggtg tcatgcattt ggtatttttt taattttagg gggggaactt        60
     gctatgactc agctatgacc gtaaaggtct cgtcgcagtc aattgatctg tagctggact       120
     tattcatctt tcatggatcg ggcatataca cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnncccctt accccccgta acttcaagaa gcttacgcac atttatgatt gccttgccaa       600
     accccaaaaa caagactaaa cgcacgtgca aacatgaagc tatcgcacct aaaaatccca       660
     catgataagc taagactccc agccaaacga ccgttgcaat cgcaggcgtg agactttaaa       720
     ttaagatcta tctatagata attttttttt tactctgtct ccctcctatt gatttttcca       780
     ttattatcgc tttacaacta ttggctctta ctaaattatc tcttataaat cctaaaacca       840
     accatgttca tgtagcttaa taacaaagca agacactgaa aatgtctaga tgagttatat       900
     aactccataa acacaaaggt ttggtcctgg ccttcctatt agctattaat aagattacac       960
     atgtaagtct ccgcgccccg gtgaaaatgc cctttagatc tcttaaatga ttcgaaggag      1020
     cgggcatcaa gcacacccct ctcccctcag agaggtagct cataacgcct tgctcagcca      1080
     cacccccacg ggatacagca gtgataaaaa ttaagccatg aacgaaagtt cgactaagct      1140
     atgttaatca aagggctggt aaatttcgtg ccagccaccg cggccacacg attagcccga      1200
     gttaataggc ctacggcgta aaacgtgtga aaggaaaaaa tcctcaccac taaagttaaa      1260
     acctaatcaa gctgtaaaaa gctatcaata gcactaaaat aaactacgaa agtgacttta      1320
     atgcttccaa ccacacgaca gctaagaccc aaactgggat tagatacccc actatgctta      1380
     gccttaaaca cagataattc accaaacaaa attattcgcc agggaactac tagcaacagc      1440
     ttaaaactca aaggacttgg cggtgcttta aaccccccta gaggagcctg ttctataatc      1500
     gataaacccc gatagacctc accacccctt gctaatccag tctatatacc gccatcttca      1560
     gctaaccctt aaaaggaaaa aaagtaagca taatcatttc acataaaaaa gttaggtcaa      1620
     ggtgtaacct atgggatggg aagaaatggg ctacattttc tatccaagaa cagtctacga      1680
     aaacttttat gaaactaaaa accaaaggcg gatttagtag taaactaaga atagagagct      1740
     tggttgaata gggcaatgaa gcacgcacac accgcccgtc accctcctca agtgacgcta      1800
     aatcaaacac aacctattgg aactagacaa atcataagag gaggcaagtc gtaacaaggt      1860
     aagcgtactg gaaagtgtgc ttggataaac caaagtgtag cttaaacaaa gcatctggct      1920
     tacacccaga agatttcaca cacatgacca ctttgaacct agagctagcc caagtgacaa      1980
     ccaattaaac tatcacagat caatcagaca aaacattcag taacacaatt aaagtatagg      2040
     agatagaaat tcttttaact ggagctatag agaaagtacc gcaagggaac gatgaaagat      2100
     tacttaaagg aataaacagc aaagattact ccttctacct tttgcataat gagttagcta      2160
     gaagcaactt agcaaagaga acttaagcta agtcccccga aaccagacga gctacctatg      2220
     aacaatccac tgggatgaac tcatctatgt cgcaaaatag tgagaagatt tataggtaga      2280
     ggtgaaaagc ctaacgagcc tggtgatagc tggttgccca gaatagaatt ttagttcaac      2340
     tttaaacttg cctgcaaaac taaaaatttt aatgctagtt taaaatatac tctaaaaagg      2400
     tacagctttt tagaaccaag gatacaacct tgcttagaga gtaaatatta atcaaaccat      2460
     agtaggccta gaagcagcca tcaattaaga aagcgttcaa gctcaacact cacactaact      2520
     taataccaaa agtatttaat caactcctaa catgataact gggccaatct attcaaatat      2580
     agaagcaaca atgctaatat gagtaacaag aaacatttct cccatgcata agcctataac      2640
     agcaacggat aaccactgat agttaacaac gacatagaaa taattcaaca ataaaacatc      2700
     tattaaacca attgttaatc caacacaggt atgcaactaa ggaaagatta aaagaagtaa      2760
     aaggaactcg gcaaatacaa accccgcctg tttaccaaaa acatcacctc cagcatttct      2820
     agtattggag gcactgcctg cccggtgaca ttagttaaac ggccgcggta tcctgaccgt      2880
     gcaaaggtag cataatcatt tgttctctaa ataaggactt gtatgaacgg ccacacgagg      2940
     gtttaactgt ctcttacttc caatcagtga aattgacctt cccgtgaaga ggcgggaata      3000
     aaataataag acgagaagac cctatggagc tttaattaat taacccaaaa gaacctacac      3060
     actaaaccaa caggaacaac atacttctct tatgggttaa caatttgggt tggggcgacc      3120
     tcggagtata aaacaacctc cgagtgatac aagtctagac atactagtcg aaatgctcac      3180
     ttacttattg atccaaagct tctttgatca acggaacaag ttaccctagg gataacagcg      3240
     caatcctatc cgagagtcca tatcgacaat agggtttacg acctcgatgt tggatcagga      3300
     catcccaatg gtgcagcagc tattaaaggt tcgtttgttc aacgattaaa gtcctacgtg      3360
     atctgagttc agaccggagc aatccaggtc ggtttctatc tattcaaata acttctccca      3420
     gtacgaaagg acaagagaaa taaggcccac tttactgaag cgccttagga ccaatagatg      3480
     atttaatcta aatctagtaa gtctacctcc tatactgccc aagaaacagg gctttgttag      3540
     ggtggcagag tccggtaatt gcgtaaaact taaactttta tacccaaagg ttcaaatcct      3600
     ctccctaaca atatgtttat aattaacatt atctcactaa tcgtaccaat tcttcttgcc      3660
     gtagctttcc taacactagt agaacgaaaa gtactaggtt acatacaact tcgaaaagga      3720
     ccaaatattg taggacccta tggcctccta caacctgtcg cagatgctgt aaagctcttt      3780
     accaaagaac ccttacgacc actcacatca tctgtaacta tatttattat agcccctatt      3840
     ctagccctaa cactagccct aaccatatga attcccctac caatgccata tcccctcatt      3900
     aacataaacc taggagtact attcatgcta gcaatatcaa gcttagctgt atattctatt      3960
     ctctgatccg gatgagcctc aaattcaaaa tatgccctaa ttggagccct acgagccgta      4020
     gcccaaacaa tctcatatga agtcacacta gccattattc tcctatcagt cctactaata      4080
     aatggctcat ttacactttc tacattaatc attactcaag aacatctctg actaatcttt      4140
     cccgcatgac cactagccat aatatgattc gtttctactt tagcagaaac caatcgggct      4200
     cccttcgacc taacagaagg agaatcagaa ctagtctcag gctttaacgt cgaatatgca      4260
     gcgggcccgt tcgctctatt tttcctagca gaatatgcca atatcatcat aataaatgcc      4320
     ctcacgacta tcctattctt cggagcattc cataatccct acataccgga actatatacc      4380
     gccaacttta ctataaaaac cctactcctg acaacttcct tcttatgaat tcgtgcatca      4440
     tacccccgat ttcgatacga ccaactaata catctactat gaaaaaactt cctacccctc      4500
     acattagccc tatgcatatg atacacaaca ctgcctatta ttacagcaag catccctccc      4560
     caaacataag aaatatgtct gacaaaagaa ttactttgat agagtaaata atagaggttt      4620
     aaatcctctt atttctagaa ttataggaat tgaacctaat cttaagaact caaaaatctt      4680
     cgtgctacct aattacacca tatcctagag taaggtcagc taaataagct atcgggccca      4740
     taccccgaaa atgttggttt atccccttcc catactaata aaacctccca ttcttattat      4800
     tattatatcc accattgccc taggaaccat aatcgtccta tttagctccc actgattcat      4860
     aatctgaatc ggttttgaaa taaatatact agcaatcatc cccattctaa taaaaaaaca      4920
     taacccacga gccgtagaag cctccacaaa atatttcctg acacaagcta ctgcatctat      4980
     actcctaata ctaggcatta ttattaactt actatactca gggcactgaa caatctcaac      5040
     aatcctcaac ccaatcgcat caaccacaat taccattgcc ctagcaataa aacttggcct      5100
     atcccccttt cacttctgag tcccagaagt tacacaaggc attcccctat cctcaggact      5160
     aatcctacta acatgacaga aaatcgcacc tttatctatc ctacatcaaa tctcaccatc      5220
     catcaaccca aacctactga tagcaatagc caccgcatcc gtattaatag gaggctgagg      5280
     aggactaaac caaactcagc tccgaaaaat tctagcatac tcctcaatcg cccacatggg      5340
     atggatagct gctatcataa tctacaatcc caccctaata atcctcaatc taataatcta      5400
     cattacaata actctaggaa cattcatact attcatacac aacttatcca caacaacact      5460
     atcactatct catacatgaa ataaatttcc actaatcacc tcattaatcc tagcacttat      5520
     attatcacta ggaggtcttc ctcccctttc aggctttatc cccaaatgaa taatcatcca      5580
     agaattaaca aaaaatgata taatcattat acctatattc atagccatca cagccttact      5640
     aaacctatac ttctatatac gcctagcata cgccacagca ctaacaatat tcccctcagc      5700
     aaacaatata aaaatgaaat gacaatttga ggctacaaaa aaggtaattc tcctaccccc      5760
     tctaattgta gcatcaacta tactcctccc actaactcca atattatcaa ccttggatta      5820
     gagatttagg ctaaaaagac caagggcctt caaagcccta agcaagtgaa actcacttaa      5880
     tctctgcaac catctaagga ctgcaagaat atatctcaca tcaattgaac gcaaaacaat      5940
     cgctttaatt aagctaagcc cttctagatc gatgggcttt tatcccacaa aactttagtt      6000
     aacagctaaa aaccctagac aactggcttc aatctacttc tcccgccgcg tagaaaaaaa      6060
     aggcgggaga agccccggca gaattgaatc tgcttctttg aatttgcaat ccaatatgat      6120
     tattcaccac agggcttggc aaaagaggac ttgaccccca tactcagatt tacagtctaa      6180
     tgcttttatc agccatttta cctatgttca taaaccgatg attattttcc acaaaccata      6240
     aagacattgg taccctttac ctcttattcg gtgcatgagc tggaatagtg ggcactgccc      6300
     tcagcctcct aatccgtgct gaactaggtc aacccggagc tctattaggg gatgatcaga      6360
     tctataatgt gatcgtaact gctcatgcat tcgtgataat cttctttata gtaatgccta      6420
     tcataattgg aggctttgga aactgattgg tgcctttaat aattggcgcc cctgatatgg      6480
     catttccccg gatgaataat ataagtttct gactgctgcc accatccttc ttgctacttc      6540
     tagcctcttc tatagtagag gcaggcgcgg gaactggttg aactgtctac ccccctctag      6600
     cgggcaatct ggcccatgca ggagcatcag tagacctaac aatcttctct ttacatttag      6660
     cgggcgtttc ctctattcta ggagctatca actttattac tactattatt aatatgaaac      6720
     cccctgcaat atctcaatat caaactcctt tattcgtatg atcggtccta attacggcgg      6780
     tacttcttct tttatcctta ccagttctag cagctgggat cactatactg ttaacagacc      6840
     gaaacctcaa tactactttc tttgatccgg caggaggagg ggatcccatt ctgtaccaac      6900
     acttgttttg attctttgga cacccagaag tttatatctt aattctccct ggattcggaa      6960
     taatctccca tattgtcaca tactactcag ggaaaaaaga gccctttggt tatataggaa      7020
     tggtttgggc aatgatatcc attggattct taggattcat cgtgtgggct catcacatgt      7080
     tcactgtagg catggatgtt gatacgcgag cctactttac ttcagcaacc ataattattg      7140
     caatcccaac aggagttaaa gtatttagct gactggctac tctacatgga ggaaatatta      7200
     aatgatcccc tgctatgata tgggccttag gctttatttt tctattcaca gtgggaggtc      7260
     tcacaggaat cgtcttggcc aactcatccc tagatattgt tcttcatgac acatattacg      7320
     tagtagccca ctttcactat gtactatcaa taggagctgt ttttgctatt ataggcggat      7380
     tcgtccattg attcccacta ttttcgggct ttatactcaa tgatacatga gcaaaaattc      7440
     actttacaat catatttgtt ggggttaata tgacattctt tccccaacac ttcctaggtc      7500
     tgtcaggaat acctcgacga tactctgatt acccagacgc ctatgcaaca tgaaacacag      7560
     tgtcttctat gggctcattc atttcactaa cagcggtcat gctgatgatt ttcataattt      7620
     gggaagcctt tgcatcaaaa cgagaagtag gaacagttga actcaccaca acaaatatcg      7680
     aatgactaca cggatgtccc cctccgtatc acacattcga ggaacccact tacattacac      7740
     taaagtaaga aaggaaggaa tcgaaccctc taaaattggt ttcaagccaa catcataacc      7800
     actatgtctc tctcaataaa gagatattag taaaaattac ataactttgt cggggttaaa      7860
     ttataggtga aaatccttta tatctctatg gcataccctt ttcaaatagg cctccaagac      7920
     gcaacttctc ccattataga agagcttcta catttccacg accatacatt aataattgta      7980
     ttcctgatta gctccttagt tctttacatt atttcaacta tattaactac caaactaacg      8040
     catacaagca caatagatgc acaagaagta gaaacggtat gaactattct accggcgatc      8100
     attctaatcc taattgcact cccatcatta cgaatcctct atataatgga tgagatcaac      8160
     aaccctttat taactgtaaa aactataggt catcaatgat actgaagtta cgaatatacg      8220
     gactatgaag acttgagctt tgattcttac atgattccaa cacaagaatt aaagcctgga      8280
     gaactacgac tgctagaagt agataatcga gtggtattac ccatagaagt aacagttcgc      8340
     atactaattt catcagaaga tgtattgcac tcatgagctg taccatccct agggctaaaa      8400
     actgatgcaa ttccaggacg actgaaccaa acaactctta tggccatgcg accaggactg      8460
     tattatggcc aatgctcaga aatctgtggc tctaaccaca gctttatacc tgttgttctc      8520
     gaactagtcc cactatctta cttcgaaaaa tgatccgctt caatattata aaatcattaa      8580
     gaagctacac agcattaacc ttttaagtta aagactgaga gtgcaagcct ctccttaatg      8640
     aagatgccac aactagatac atcaacatgg tttatcacaa ctctatctat agtcttagca      8700
     ctatttattg tattccaatt aaaaatccta aagtacaatt actctgaaac ccctggacta      8760
     aaatcctctc tgtcactaaa aaaaactata ccctgagaaa aaaaatgaac gaaaatttat      8820
     ttgcctcttt tattacccca acaataatag gagtccccat tgtagtccta atcgtcgtat      8880
     tcccaagtat tctatttcca tcccctagtc gactgattaa taaccgctta gtttctattc      8940
     aacagtgact agtccagcta acatcaaagc agatattgtc cattcacaat cacaagggac      9000
     aagcctgagc actgatatta atatcactga tcttatttat tggttcgacc aaccttctag      9060
     gtctactacc acactcattt acgcctacca cacaactatc aatgaactta ggaatagcca      9120
     ttcccttatg agcgggcaca attgtcatcg gatttcgata taaaaccaaa gcatctctgg      9180
     ctcacctcct accccaagga acaccctttc ccctaattcc gatactcgtg attattgaaa      9240
     ctattagtct attcattcaa cccatggcct tagccgtgcg actaaccgcc aatatcactg      9300
     cgggtcacct acttattcat ctaattggag gagctactct agctttaaca aacattagcg      9360
     tcgctacagc cctcatcact ttcactgtcc tagtactact cactattctt gagttcgctg      9420
     tggctcttat ccaagcctat gtcttcactc tactagtaag tctatactta catgataaca      9480
     cctaatgacc caccaaacac atgcatatca tatggttaac ccaagtccat gaccactaac      9540
     aggggccctt tcagccctcc ttataacatc gggactaatc atatgattcc actttaactc      9600
     aatatccttg ctactactag gccttacaac taacatactt accatatacc aatgatgacg      9660
     agacattatc cgagaaagca cttttcaggg ccaccacact cccgtcgttc aaaaaggatt      9720
     acgatatggg ataatcctat ttattgtatc agaggtgttc ttcttcacag gattcttctg      9780
     agcgttttac cattcaagtc tagcgcccac ccccgaacta ggagcatgct gaccacccac      9840
     aggtattatc cccctaaatc cactggaagt accacttctt aatacctcag tactcctagc      9900
     gtctggagta tctattacct gagcccacca tagcttaatg gaaggaaatc gcaatcacgc      9960
     acttcaagct ctacttatta ctatctcctt aggcgtatac tttacgctct tacaagcctc     10020
     agaatattac gaagcatctt ttactatttc agacggaatc tatggctcaa ctttcttcgt     10080
     agcaactgga ttccatgggc tccatgtaat tatcggctca actttcctca ttatctgctt     10140
     cctacgacaa ctacactttc attttacatc aaaccatcac tttggctttg aggcagcagc     10200
     atgatactga cacttcgtag atgtcgtgtg actattccta tatgtctcta tctattgatg     10260
     aggatcttgc ctctttagta ttaattagta caattgattt ccaatcaatt agttccggta     10320
     caatccagaa agaagcaatt aacctaattc tagcactatt cactaacacg ctgctagcct     10380
     ccttactcgt tctcatcgca ttctgactac cacaattgaa tatctacgcg gaaaaggtaa     10440
     gtccttatga atgcgggttc gaccccatag gatcggcacg cctccctttt tccataaaat     10500
     ttttcctggt agccatcaca ttcctactat tcgacttgga aatcgcacta ctccttcctc     10560
     ttccctgagc attacaagcc aagaacccaa caactgtact tattacggca ttactactca     10620
     tctctttact ggctgcaagc ctagcctacg aatgaactga aaaaggacta gactgaaccg     10680
     aatatgataa ttagtttaag ctaaaaacaa atgatttcga ctcattaaat tatgaacagt     10740
     atcataatta tcaagtgtcc atagtctata ttaatatttt cctagccttt attgtgtccc     10800
     taataggact acttatctat cgatctcacc tgatatcctc cctactctgt ctagagggta     10860
     tgatattatc tttatttgtt atgctagcag tgactgtcct aaacaaccat ttcacactag     10920
     ccagcataac cccaatcatc ctactagtat ttgctgcctg tgaagcggca ctaggactat     10980
     ccctgttagt aatagtctct aacacctatg gaaccgacta cgtacaaaac cttaacctcc     11040
     tacaatgcta aaaattattc ttcccactat aatgctgata cctcttacat gaacatcaaa     11100
     acccaatata atctgaatca atacaacaac ttatagtcta ctcattagcc tcattagcct     11160
     aacatacctt aatcaactca gtgacaacag cctaaacttc tcactactat tctttaccga     11220
     ctccctatca gctcccctac tagtccttac aacatgactg ctccccctaa tactaatagc     11280
     cagtcaattc cacctgtcaa aggagaccct gactcgaaag aaactataca ttaccatact     11340
     aattctctta caactattcc taatcataac attctccgcc atagaactaa tcctatttta     11400
     catcctattt gaggccaccc tagtacccac tttaatcatt atcactcgat gagggaacca     11460
     aacggaacga ttaaatgcgg gtctttactt tcttttctac accctagtag gatctttgcc     11520
     cttactgatt gcactactac atacccaaaa caatctaggt tccttaaact ttctcataat     11580
     acaatactga acccaacccc taccgaactc ttgatccagt atcttcttat gactagcatg     11640
     catgatggca ttcatggtaa aaatacccct atacggtctt cacctatgat tgccaaaagc     11700
     acacgtagaa gctcccatcg caggatctat ggtgctcgcc gccgtacttc taaaactagg     11760
     aggctacggt ataatacgaa tcacaacact gctcagcccc ttaacaaact ctatggctta     11820
     cccctttata atactttcac tatgaggcat aattatgacg agttccattt gcctacgcca     11880
     agcagatcta aaatccctaa ttgcctactc ctctgtcagc cacatagccc tagtaattgt     11940
     agcagtatta atccaaaccc catggagtta cataggagca acagctctaa tgattgccca     12000
     cggattgaca tcctctatac tgttctgcct tgcaaattcc aactacgagc gaactcacag     12060
     ccgaattata atccttgcac gaggcctaca aacactcctc ccgctcatag cagcctgatg     12120
     actcctagca agcctcacta atctggcgct tccccctact attaacctca ttggagagct     12180
     atttgtagta atagcctcat tttcatggtc taacactacc attgttctaa taggaaccaa     12240
     cattatcatt accgccctct actccctcta catattaatt accacacaac gaggcaaata     12300
     cacggaccac attaaaaaca tcaaaccatc cttcacacga gaaaacgccc taatagccct     12360
     tcatttacta cccctcctac tgctatctct caaccctaaa ataattctgg ggcccgttta     12420
     ttgtaaatat agtttaacaa aaacattaga ttgtgaatct aataacaaaa gctcaaacct     12480
     ttttatttac cgaaaaagta cgcaagaact gctaattcat gtacccatgc ataaaaccat     12540
     ggctttttca acttttaaag gatagaagta atccattggt cttaggaacc aaaaaattgg     12600
     tgcaactcca aataaaagta atcaatctat ttacctcctc cgttattaca gccctgctca     12660
     tactaacaat accaatcatc ctaactagca cttcagtata taaagataaa tcctacccac     12720
     aatatgtaaa aactacaatt tcttatgcct ttatggttag caccatcccc ataataatat     12780
     ttatcttctc aggacaagaa acagtcatct cgaactgaca ctgaataaca atccaaactc     12840
     taaaattaac actcagcttt aaactagact acttctcaat aatttttata ccagtagccc     12900
     tatttgtcac atgatcaatc acagagttct ccatatgata tatacacgct gaccctaaca     12960
     ttaatcggtt ctttaaatat ctcctcatat tccttattac catgataacc ttagtaaccg     13020
     caaacaacct attccaatta tttattggct gagaaggagt aggaattatg tccttcctcc     13080
     ttattgggtg gtgatatggc cgaacagacg ccaatacagc cgccttacaa gcagttctat     13140
     acaaccgcat cggagacgta ggctttatca tggctatagc ctgatttcta ctcaatacaa     13200
     atgcatgaga cttccaacaa atctttataa tcggccataa agaccttaat accccactgg     13260
     taggtctact cttagcagcc accggaaaat cagcccaatt cggactccac ccatgacttc     13320
     catcggccat ggaagggccc acccccgtct cagccctact ccactccagt acaatagtag     13380
     tggcaggagt ttttctctta attcgatttc accctctaat agaacacaac aaaactattc     13440
     aaacaactac cctatgtctg ggagcaataa cgactctatt cacagcaatc tgcgccctaa     13500
     cccaaaacga catcaaaaaa attattgcct tttccacttc gagccaactg ggattaataa     13560
     tcgtgacaat tggaattaac caaccccacc tggcattcct tcatatctgt acacatgcat     13620
     tcttcaaagc tatactattt atatgctctg gatccattat ccacaacctg aacaacgaac     13680
     aggatatccg aaaaataggg ggcctattca aagtcctacc atttacttcc actgcactga     13740
     tcgtcggaac cttagctctc acaggaatac ctttccttac aggattctat tctaaagacc     13800
     tgatcatcga aactgccaac acgtcataca tcaacgcttg ggccctacta acaacccttg     13860
     ccgctacatc catgactgct gcctacagta ctcgaatcgt attctttgca cttctaggac     13920
     aaccccgctt taatcccact gttactatca acgagaataa tcctctttta atcaactcta     13980
     tcaaacgcct actattagga agcatcctcg caggatattt aatctcccac agcattgcac     14040
     ccataaacat cccacaaata accataccct attacttaaa aataacagcc cttgcagtga     14100
     ctaccctagg ctttatccta gcactagaac ttaatcttac tgcgcaaggt ctcaaattcg     14160
     attatccatt aaacccattc aaattttcca tccaactggg atatttcccc actatcatcc     14220
     accgctccgt gccaataata agcctatcaa taagtcaaaa agcagcgtcc atgctactag     14280
     acgcaatctg gctggaaaac gtattaccaa aatctatctc ctactttcag ataaaatcct     14340
     caactacgat ctccaatcaa aaaggactga tcaaactata ctttctatcc ttcataatta     14400
     cactgctcct aagcttcctt gtacttaatt tccacgagta acttccacaa ttaccaatac     14460
     tccaataaga agagaccatc cggtgacaat aactaatcaa gtcccataac tatataatgc     14520
     tgcaatcccc atggcctcct cactaaaaaa tcctgaatct cctgtatcat aaatcaccca     14580
     atcacccatt ccattaaact taaatacaat ttcaatctca tcgtccttta agacataaca     14640
     aacaaccaac aactcagata gtaaccccac gataaatgca cccaatacag ccttattaga     14700
     aatccaaact tcagggtact gctcagtagc catagccgta gtataaccaa aaaccacaag     14760
     tattccacct aaataaatta aaaaaactat caaacctaaa aaagaccccc caaaattcaa     14820
     cacaatacca cacccaacac ccccactaac aattaaaacc aatcctccat aaataggaga     14880
     aggcttagaa gaaaagccca caaaacctat tacaaaaaca acactcaaaa tgaacacgat     14940
     atatgttatc attattccta catggaattt aaccatgact aatgacatga aaaatcatcg     15000
     ttgtatttca actataagaa ttttaatgac caacatccga aagactcacc cactggccaa     15060
     aattatcaat aactcattca tcgacctccc aacaccatca aatatctcag catgatgaaa     15120
     cttcgggtcc cttcttggag tatgcctagt cctacaaatc ctaacgggcc tattcctggc     15180
     tatacactat acggcagaca cgactacagc cttttcatca gtcacccata tttgtcgaga     15240
     tgttaactac ggatgaatta tccgatatat acacgcaaat ggggcctcaa tattcttcat     15300
     ctgcttattc atacacgtag gacggggcct gtattacggc tcatacctgt tctcagagac     15360
     atgaaatatc ggtattattc tcctatttac aactatagcc acagcattca tagggtacgt     15420
     cttaccctga ggccaaatat ccttttgagg agcaaccgtc atcaccaacc tgctatcagc     15480
     cattccctat attggaaccg atctggtaga atgaatctga ggaggttttt ctgtagataa     15540
     agcaacccta acacgatttt ttaccttcca ctttatcctt ccattcatca tcttagcact     15600
     agcagcggtt cacctgctac tcctacacga aacaggatcc aacaatccct ccggaattcc     15660
     atccaactca gacaaaatcc catttcaccc atactacaca atcaaagaca tcctgggtgc     15720
     tctatttctt atcttaaccc taataactct agtcttattt tcacctgacc tattgggaga     15780
     ccccgacaac tacacccccg caaatccact aagtactcca ccgcatatca agcctgagtg     15840
     atatttccta tttgcctacg ccatcctacg atctattccc aataaactag gaggagtact     15900
     agccctagtt ttctcaatcc tagttctagc tattatccct ctgctacaca catccaagca     15960
     acgaggaata atattccgac ctctaagcca atgcctattc tgacttctaa cagcggacct     16020
     gctaacacta acatgaattg ggggacaacc agtagaatac ccctttatta ttattggaca     16080
     actagcctcc atcctctact tcacaatcct tctagtactt atacctgtcg ccggaatcat     16140
     tgaaaataac ttctcaaagt gaagagtctt tgtagtataa taattacctt ggtcttgtaa     16200
     gccaaaaatg gagaacactc atcctcccca agactcaagg aagaaacaac agctccacca     16260
     tcagcaccca aagctgacat tctatttata aactattccc tgataccatt attccaccct     16320
     gtgtcttatc tatttcatat ataccatcct atgtactgta ccatcttagt atgtcctcgg     16380
     acaagaggac tattcttttt tttccccccc tatgtatatc gtgcattaat ggcgtgcccc     16440
     atgcatataa gcatgtacat gttgtgcttg gttttacatg aggacatact cttcaaaagc     16500
     ttgttttgaa ggtatggtct gtaagcatgt atttcactta gtccgggagc ttagtcacca     16560
     ggcctcgaga aaccagcaac ccttgcgagt acgtgtacct cttctcgctc cgggcccata     16620
     gaaacgtggg ggtttctaca ctgaaactat acctggcatc tggttcttac ttcagggcca     16680
     tgatagctct agattccaat cctactaacc cttcaaatgg gacatctcga tggactaatg     16740
     actaatcagc ccat                                                       16754
//


spacer
spacer