spacer

EBI Dbfetch

ID   FM177760; SV 1; circular; genomic DNA; STD; MAM; 16780 BP.
XX
AC   FM177760;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Ursus spelaeus complete mitochondrial genome
XX
KW   complete genome.
XX
OS   Ursus spelaeus (cave bear)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ursus.
OG   Mitochondrion
XX
RN   [1]
RP   1-16780
RA   Krause J.;
RT   ;
RL   Submitted (23-JUN-2008) to the INSDC.
RL   Krause J., Evolutionary Genetics, Max Planck Institute, Deutscher Platz 6,
RL   04103 Leipzig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-220.
RX   PUBMED; 18662376.
RA   Krause J., Unger T., Nocon A., Malaspinas A.S., Kolokotronis S.O.,
RA   Stiller M., Soibelzon L., Spriggs H., Dear P.H., Briggs A.W., Bray S.C.E.,
RA   O'Brien S.J., Rabeder G., Matheus P., Cooper A., Slatkin M., Paabo S.,
RA   Hofreiter M.;
RT   "Mitochondrial genomes reveal an explosive radiation of extinct and extant
RT   bears near the Miocene-Pliocene boundary";
RL   BMC Evol. Biol. 8:220-220(2008).
XX
DR   MD5; 6bf8a9b178ed4e4bf14c65ca0766b892.
DR   EuropePMC; PMC2518930; 18662376.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16780
FT                   /organism="Ursus spelaeus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Austria:Gamssulzen cave"
FT                   /db_xref="taxon:39097"
FT   D-loop          join(1..879,16324..16780)
FT   repeat_region   221..550
FT                   /rpt_type=TANDEM
FT                   /note="microsatellite"
FT   tRNA            880..948
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT   rRNA            949..1911
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   tRNA            1912..1977
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT   rRNA            1978..3557
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            3558..3632
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             3635..4590
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:4589..4590,aa:TERM)
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F8"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F8"
FT                   /protein_id="CAQ68417.1"
FT                   /translation="MFMINIISLVVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGL
FT                   LQPIADAMKLFTKEPLRPLTSSTTMFIMAPILALTLALTMWVPLPMPYPLVNMNLGVLF
FT                   MLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLS
FT                   TLITTQEHLWLIFPTWPLAMMWFISTLAETNRAPFDLAEGESELVSGFNVEYAAGPFAL
FT                   FFLAEYTNIIMMNALTTILFFGAFHSPCMPELYTVNFTVKTLLLTASFLWIRASYPRFR
FT                   YDQLMHLLWKNFLPLTLALCMWHVTLPIITASIPPQM"
FT   tRNA            4591..4659
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            complement(4657..4729)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            4731..4799
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT   CDS             4800..5841
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:5841,aa:TERM)
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F9"
FT                   /protein_id="CAQ68418.1"
FT                   /translation="MKPPILIIITSTIILGTTIVLFSSHWLMIWIGFEMNMLAIIPILM
FT                   KKFNPRAMEASTKYFLTQATASMLLMLGIIINLLHSGHWTISMIPNPIASTVITIALAM
FT                   KLGLSPFHFWVPEVTQGISLSSGMILLTWQKIAPLSVLYQISPSINPNLLVAMAATSVL
FT                   VGGWGGLNQTQLRKILAYSSIAHMGWMAAIMVYNPTLMILNLTIYIMMTLGTFMLFMYN
FT                   LSTTTLSLSHTWNKSPLIASLILALMLSLGGLPPLSGFIPKWMIIQELTKNDMIIMPMF
FT                   MAITALLNLYFYMRLTYATALTMFPSANNMKMKWQFESMKKMIFLPPLIVASTMLLPLT
FT                   PMLSIMN"
FT   tRNA            5842..5908
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT   tRNA            complement(5917..5985)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT   tRNA            complement(5986..6058)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(6092..6158)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT   tRNA            complement(6159..6225)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   CDS             6227..7771
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxI"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="GOA:B5B8G0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G0"
FT                   /protein_id="CAQ68419.1"
FT                   /translation="MFMNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPG
FT                   ALLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASMDLTIFSLHLAGISSILGAIN
FT                   FITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMW
FT                   ALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL
FT                   FSGYTLNNTWAKIHFMIMFIGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSVGS
FT                   FISLTAVMLMIFMIWEAFASKREVAVVELTSTNIEWLHGCPPPYHTFEEPAYVMLK"
FT   tRNA            complement(7769..7837)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            7844..7910
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT   CDS             7911..8594
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxII"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="GOA:B5B8G1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G1"
FT                   /protein_id="CAQ68420.1"
FT                   /translation="MAYPFQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISTM
FT                   LTTKLTHTSTMDAQEVETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQW
FT                   YWSYEYTDYEDLNFDSYMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQTALMAMRPGLYYGQCSEICGSNHSFMPIVLELVPLSYFEEW
FT                   SASVL"
FT   tRNA            8598..8665
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT   CDS             8668..8871
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="atp8"
FT                   /product="ATP synthase F0 subunit 8"
FT                   /db_xref="GOA:B5B8G2"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G2"
FT                   /protein_id="CAQ68421.1"
FT                   /translation="MPQLDTSTWSITILSMVLTLFIILQLKVSKYKYPEIPEPKSLLSS
FT                   KKLVPWEEKWTKIYLPLLSPQR"
FT   CDS             8829..9508
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:9507..9508,aa:TERM)
FT                   /gene="atp6"
FT                   /product="ATP synthase F0 subunit 6"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8G3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G3"
FT                   /protein_id="CAQ68422.1"
FT                   /translation="MNENLFTSFITPTMMGIPIVLLIIMFPSILFPSSSRLIDNRLVSV
FT                   QQWLVRLTSKQMLSIHNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGM
FT                   AIPLWAGTVATGFRYKTKASLAHFLPQGTPFPLIPMLVIIETISLFIQPMALAVRLTAN
FT                   ITAGHLLIHLIGGATLALTSISTITACIAFTILVLLTILEFAVALIQAYVFTLLVSLYL
FT                   HDNT"
FT   CDS             9509..10292
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10292,aa:TERM)
FT                   /gene="coxIII"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8G4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G4"
FT                   /protein_id="CAQ68423.1"
FT                   /translation="MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSMLLLLL
FT                   GLTTNMLTMYQWWRDIIRESTFQGHHTPAVQKGLRYGMVLFIVSEVFFFAGFFWAFYHS
FT                   SLAPTPELGACWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRKHMLQAL
FT                   FITISLGVYFTLLQASEYYEASFTISDGVYGSTFFMATGFHGLHVIIGSTFLTVCFLRQ
FT                   LHFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
FT   tRNA            10293..10361
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT   CDS             10362..10708
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10707..10708,aa:TERM)
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8G5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G5"
FT                   /protein_id="CAQ68424.1"
FT                   /translation="MNLILALFTNMLLASLLVLIAFWLPQLNIYAEKASPYECGFDPMG
FT                   SARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTDNLMTMLTMALLLISLLAMSLAY
FT                   EWAEKGLEWAE"
FT   tRNA            10709..10777
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT   CDS             10778..11074
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:B5B8G6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G6"
FT                   /protein_id="CAQ68425.1"
FT                   /translation="MPVVYVNIFLAFIVSLMGLLIYRSHLMSSLLCLEGMALSLFVMLT
FT                   VTVLNNHFTLANMAPIILLVFAACEAALGLSLPVMVSNTYGTDYVQNLNLLQC"
FT   CDS             11068..12445
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:12445,aa:TERM)
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8G7"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G7"
FT                   /protein_id="CAQ68426.1"
FT                   /translation="MLKIIFPTMMLMPLTWASKPNMIWINTTAYSLLISLISLTYLNQL
FT                   SDNSLNFSLLFFTDSLSAPLLALTTWLLPLMLMASQFHLSKETLTRKKLYITMLILLQL
FT                   FLIMTFSAMELILFYILFEATLVPTLVIITRWGNQTERLNAGLYFLFYTLVGSLPLLIA
FT                   LLHTQNNLGSLNFLMMQYWIQPLPNSWSSIFLWLACMMAFMVKMPLYGLHLWLPKAHVE
FT                   APIAGSMVLAAVLLKLGGYGMMRITTLLNPLTSFMAYPFMMLSLWGMIMTSSICLRQTD
FT                   LKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERIHSR
FT                   TMILARGLQTLLPLMAAWWLLASLTNLALPPTINLIGELFVVVATFSWSNITITLMGTN
FT                   IIITALYSLYMLITTQRGKCTDHIKSIKPSFTRENALMALHLLPLLLLSLNPKMILGPI
FT                   Y"
FT   tRNA            12446..12514
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT   tRNA            12515..12573
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            12574..12643
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             12644..14473
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:B5B8G8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G8"
FT                   /protein_id="CAQ68427.1"
FT                   /translation="MNLFTSSIIMTLLMLMMPIILTSTSTHKNKFYPQYVKTTVSYAFM
FT                   VSTIPMMMFLYSGQEMIISNWHWMTIQTLKLTLSFKLDYFSMIFMPVALFVTWSIMEFS
FT                   IWYMHTDPNISHFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAVLYNRIGDVGFIMAMAWFLLNTNAWDFQQIFAIEHENLNIPLAGLLLAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFYPLMEHNKTIQTATLCLG
FT                   AMTTLFTAACALTQNDIKKIIAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLF
FT                   MCSGSIIHSLNDEQDIRKMGGLFKALPLTTTALIIGALALTGMPFLTGFYSKDLIIETA
FT                   NTSYTNAWALLTTLIATSMTAAYSTRIVFFVLLGQPRFNPVIVINENSPLLINSIKRLL
FT                   LGSIFAGYLIFHNITPTTTPQMTMPHYLKMMALAVTMLGFILALELNSISQTLKLDYPQ
FT                   NLFKFSIQLGYFPIIIHRLLPMMSLSMSQKMASMLLDMIWLENALPKSISYFQMKSSIM
FT                   VSNQKGLIKLYFLSFMITLTLSFFVLNFHEWLP"
FT   CDS             complement(14448..14975)
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:B5B8G9"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8G9"
FT                   /protein_id="CAQ68428.1"
FT                   /translation="MMMYIVFILSTIFVMGFVGFSSKPSPIYGGLVLIISGGVGCGIVL
FT                   NFGGSFLGLMVFLVYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLGAFIVGLLSELLIA
FT                   CYVLKDDEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLI
FT                   GVLVIMEVTRGN"
FT   tRNA            complement(14976..15044)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT   CDS             15049..16188
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B5B8H0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8H0"
FT                   /protein_id="CAQ68429.1"
FT                   /translation="MTNIRKTHPLAKIINNSFIDLPTPSNISAWWNFGSLLGVCLVLQI
FT                   LTGLFLAMHYTSDTTTAFSSITHICRDVHYGWVIRYMHANGASMFFICLFMHVGRGLYY
FT                   GSYLFSETWNIGIILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIILALAAVHLLFLHETGSNNPSGIPSNSDKIPFHP
FT                   YYTIKDILGALLLTLALATLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIFSILILAIIPLLHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGG
FT                   QPVEHPFIIIGQLASILYFTILLVLMPIAGIIENNLLKW"
FT   tRNA            16189..16258
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(16258..16323)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
XX
SQ   Sequence 16780 BP; 5272 A; 4256 C; 2549 G; 4703 T; 0 other;
     gatcacacat aactgtggtg tcatgcattt ggtatctttt aatttttagg gggggaactt        60
     gctatgactc agctatgacc gtaaaggtct cgtcgcagtc aaataatttg tagctgggct       120
     tatttatctt tcacgggtcg ggcatagata cccataaggg gttactcagt caatggtcgc       180
     aggacatata gtatgtgaac gccactaaat cgaacgaaca gcgcacgtat acgcatacgt       240
     acgcatacgt acgcatacgt acgcatacgt acgcatacgt acgcatacgt acgcatacgt       300
     acgcatacgt acgcatacgt acgcatacgt atgcatacgt acgcatacgt acgcatacgt       360
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       420
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       480
     acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt acgcacgtgt       540
     acgcacgcgt ttttagatat taacttagct taatcaaacc ccccttaccc cccgtaactt       600
     caaggagctt acgcacattt atggttgtct tgccaaaccc caaaaacaag actaaatgta       660
     catgcaaaca tgaagctatc atatccaaaa tcccacataa taagctaaaa ttcccagcca       720
     aataattact gtaatcacag gcatgaaact ttaaattaag atctatctat agatattttt       780
     tttttactct gcttccctcc tattgatttt tccgttatta tcactttttg gccacgagct       840
     tttactaaat tatctcttac aaatcccaaa accaaccacg tttattgtag cttaatagta       900
     aagcaaggca ctgaaaatgc ctagacgagt tatataactc cataaacata aaggtttggt       960
     cctggccttc ccattagcta ctaacaagat tacacatgca agtctccgcg ctccagtgaa      1020
     aatgcccttt ggatcttaaa gcgatttgaa ggagcgggca tcaagcacac ctctccccgg      1080
     tagcttataa cgccttgcct agccacgccc ccacgggata cagcagtgat aaaaattaag      1140
     ccatgaacga aagttcgact aagctatgtt gattaagggt tggttaattt cgtgccagcc      1200
     accgcggtta tacgattgac ccgagttaat aggcccacgg cgtaaagcgt gtgaaagaaa      1260
     aaaatttccc tactaaagtt aaagtttaac ccagctgtaa aaagctatca gtaacactaa      1320
     aataaactac gaaagtgact ttaatactct caaccacacg atagctaaga tccaaactgg      1380
     gattagatac cccactatgc ttagccttaa acataaataa tttactaaac aaaattattc      1440
     gccagagaac tactagcaac agcttaaaac tcaaaggact tggcggtgct ttaaaccccc      1500
     tagaggagcc tgttctgtaa tcgataaacc ccgatagacc tcaccacctc ttgctaattc      1560
     agtctatata ccgccatctt cagcaaaccc ttaaaaggaa taaaagtaag cacaatcatc      1620
     tcgcataaaa aagttaggtc aaggtgtaac ccatggggtg ggaagaaatg ggctacattt      1680
     tctattcaag aacaacttac gaaagttttt atgaaattaa aaactaaagg tggatttagt      1740
     agtaaatcaa gaatagagag cttgattgaa taaggcaatg aagcatgtac acaccgcccg      1800
     tcaccctcct caagtgacat aagccaaaca taacctattg aaaccaaata aaacgcaaga      1860
     ggagacaagt cgtaacaagg taagcatact ggaaagtgtg cttggatgga tcaaagtgta      1920
     gcttaaacaa agcatctggc ttacacccag aggatttcac gcatgtgacc actttgaacc      1980
     cagagctagc ccggacaaca actaaccaaa ctaccataaa ccaattaaac aaaacattca      2040
     ataatacaat taaagtatag gagatagaaa ttcttttaat cggagctata gagaaagtac      2100
     cgcaagggaa tgatgaaaga ttacttaaag taataaacag caaagattat cccttctacc      2160
     ttttgcataa tgagttagcc agaaataacc taacaaagag aacttaagct aggtcccccg      2220
     aaaccagacg agctacctat gaacaatcca ctggggtgaa ctcatctatg tcgcaaaata      2280
     gtgagaagat ttataggtag aggtgaaaag cctaacgagc ctggtgatag ctggttgccc      2340
     agaatagaat tttagttcaa ctttaaactt gcctacaaaa cttaaaaatt tcaatgcaag      2400
     tttaaaatat attctaaaaa ggtacagctt tttagaatca aggatacaac cttacttaga      2460
     gagtaaatac taattaaacc atagtaggct tagaagcagc catcaattaa gaaagcgttt      2520
     aagctcaaca tccatgtcaa cttgatacca aaaatattta attaactcct aatataacaa      2580
     ctgggctaat ctatttaaat atagaagcaa caatgctaat atgagtaaca agaagtattt      2640
     ctccaacgca taagtttata acagcaacgg ataaccactg atagttaaca ataacgtaga      2700
     aataatccaa caataaaaca cctaccaaac caattgttaa tccaacacag gtatgcgact      2760
     aaggaaagat taaaagaagt aaaaggaact cggcaaacac aaaccccgcc tgtttaccaa      2820
     aaacatcacc tccagcattc ccagtattgg aggcactgcc tgcccggtga cattagttaa      2880
     acggccgcgg tattttgacc gtgcaaaggt agcataatca tttgttctct aaataaggac      2940
     ttgtatgaaa ggccacacga gggtttaact gtctcttact tccgatcagt gaaattgacc      3000
     ttcccgtgaa gaggcgggaa taaaacaata agacgagaag accctatgga gctttaatta      3060
     actagcccaa aaggatctat ttaccagacc gacaggaaca acatattcct tccatgagct      3120
     aacaatttag gttggggcga cctcggagca taaagcaacc tccgagtggt attaatctag      3180
     acgtaccagt caaaatgctc acttacttat tgatccaaaa cctctttgat caacggaaca      3240
     agttacccta gggataacag cgcaatccta ttcaagagtc catatcgaca atagggttta      3300
     cgacctcgat gttggatcag gacatcctaa tggtgcagca gctattaagg gttcgtttgt      3360
     tcaacgatta aagtcctacg tgatctgagt tcagaccgga gcaatccagg tcggtttcta      3420
     tctattcaaa tgacctctcc cagtacgaaa ggacaagaga agtaaggcct ccctcactaa      3480
     ggcgccttaa gaccaataga tgacctaatc taaatctagt aagtctaccc ccaatgttgc      3540
     ccaagaaaca gggccttgtt agggtggcag agcccggtga ttgcataaaa cttaaacctt      3600
     tatactcaga ggttcaaatc ctctccctaa tactatgttt atgatcaaca ttatctcact      3660
     agttgtaccc attctcctcg ccgtagcctt cctaacacta gtagagcgaa aagtactggg      3720
     ctatatacaa cttcgtaaag gaccaaacat tgtaggaccc tatggtctcc tgcaacctat      3780
     cgcagatgct ataaaacttt ttaccaaaga acccttgcgc ccacttacat cgtctacgac      3840
     tatgttcatt atagccccta ttctagccct aacactagcc ctaactatgt gagttcctct      3900
     accaatgcca tacccccttg tcaacataaa ccttggagtg ttgtttatat tagcaatatc      3960
     aagtctagct gtatattcta tcctttgatc gggatgagct tcaaactcaa aatacgctct      4020
     aattggagct ctacgagccg tagcccaaac aatttcatat gaagtcacat tagccatcat      4080
     cctcctatca gtcctactaa tgaatggctc attcacactt tctactttaa ttactactca      4140
     agagcacctc tgactaattt tccccacatg acctctggcc ataatatgat ttatctccac      4200
     cctagcagaa actaaccgag ccccttttga cctagcagaa ggagagtcag aattagtctc      4260
     aggcttcaac gtcgagtacg cagcaggccc attcgcccta tttttcttag cagaatatac      4320
     caacattatt ataataaatg ccctcacgac tatcctgttc ttcggagcat ttcacagccc      4380
     ctgtatacca gaactataca ccgttaactt cactgtaaaa acactactcc taacagcttc      4440
     tttcctatga atccgtgcat catacccccg attccgatac gatcaactaa tacacctact      4500
     atgaaaaaat ttcctacccc tcacactggc cctgtgcatg tgacatgtaa cactacctat      4560
     tatcacagca agcattcctc ctcagatata agaaatatgt ctgacaaaag aattactttg      4620
     atagagtaaa taatagaggt taaaatcctc ttatttctag aattatagga atcgaaccta      4680
     atcttaagaa ctcaaaaatc ttcgtgctac ctaattacac catatcctag agtaaggtca      4740
     gctaaataag ctatcgggcc cataccccga aaatgttggt tcatcccctt cccgtactaa      4800
     taaaaccacc cattcttatc attatcacat ccaccattat cctaggaacc acgatcgttc      4860
     tattcagctc ccactgactc ataatctgaa ttggctttga aataaacatg ctagctatta      4920
     tcccaatcct aatgaaaaaa tttaatccac gggccataga agcttctaca aaatatttcc      4980
     tcacacaagc cactgcatcc atgctcctga tactaggcat tattatcaac ttactacatt      5040
     caggacactg aacaatctca ataatcccca atccaatcgc atcaactgta atcactattg      5100
     ccctagcaat aaaacttggc ctatccccct ttcacttttg agtcccagaa gtcacacaag      5160
     gtatttcttt gtcctcagga ataattctac taacatgaca aaaaatcgca cctctatccg      5220
     tcctatatca aatttcacca tccatcaacc caaacctact agtagcaata gccgctacat      5280
     ccgtattagt aggaggctga ggaggactaa accaaactca actccgaaaa atcctagcat      5340
     actcttcaat cgctcacatg ggctgaatag ctgccattat agtatacaac ccaaccttaa      5400
     taattctcaa cctcacaatc tacatcataa taactttagg gacatttata ctatttatgt      5460
     acaatttatc tacaacaaca ctatcactat cccacacatg aaataaatca ccactaattg      5520
     cctcactaat cctagcactt atactatcac taggcggcct ccctcccctc tcaggcttta      5580
     ttcccaaatg aataatcatt caagagttga caaaaaatga tataattatt atacccatat      5640
     tcatagccat cacagctcta ttaaaccttt atttctacat gcgtctaaca tatgctacag      5700
     cactaacaat gtttccctca gcaaacaata taaaaataaa atgacagttt gaaagcataa      5760
     aaaaaataat cttcctaccc cctctaattg tagcatcaac catacttctt ccactaactc      5820
     caatactatc aatcatgaac tagagattta ggctaaaaag accaagggcc ttcaaagccc      5880
     taagtaagtg aaattcactt aatctctgca actatttaag gactgcaaga gcatatctca      5940
     catcaattga acgcaaaaca accgctttaa ttaagctaag ccctcctaga tcggtgggct      6000
     tttgtcccac aaaattttag ttaacagcta aaaaccccaa acaactggct tcaatctact      6060
     tctcccgccg cgtaggaaaa aaaggcggga gaagccccgg cagaattgaa tctgcttctt      6120
     tgaatttgca attcaatatg attattcacc acagagcttg gcaaaaagag gacttaacct      6180
     ctattcttag atttacagtc taatactttt atcagccatt ttacctatgt tcataaatcg      6240
     gtgattattc tctacgaacc ataaagacat tggcactctt taccttctat tcggtgcatg      6300
     agccggaata gtgggtactg ccctcagcct tttaattcgt gccgagctgg gtcagcctgg      6360
     ggccctgttg ggggatgatc agatctacaa tgtagtcgta actgcccatg cgttcgtgat      6420
     aatcttcttc atagtcatac ctattataat tggggggttc gggaactgat tagtgccctt      6480
     aatgatcggt gcccccgaca tagcgtttcc tcgaatgaat aacataagct tctggttact      6540
     gccaccatcc ttcttattgc ttctggcctc ttctatggta gaagcaggtg caggaactgg      6600
     atgaactgtc tacccccctc tagcgggtaa tctggcccat gcaggagcat caatagacct      6660
     aacaatcttt tctctgcacc tagcaggtat ctcttctatt ctgggagcta ttaatttcat      6720
     cactactatt attaacatga agccccctgc aatatctcaa tatcaaacac ctctatttgt      6780
     atgatcagtc ctaatcacag ccgtacttct tcttttatct ttaccagtct tagcagctgg      6840
     gattactata ctacttacag atcgaaacct caatactacc ttttttgacc cagcaggagg      6900
     gggagaccct attttatatc aacacttgtt ctgattcttc ggacaccctg aggtttacat      6960
     cttaatcctt cctgggttcg gaatgatttc tcacattgtc acttattatt caggaaaaaa      7020
     agaacctttt ggctatatag gaatagtctg agcgataatg tctattggat tcttgggatt      7080
     tatcgtatga gctcaccaca tgtttaccgt aggtatagac gtcgacacac gagcttactt      7140
     cacttcagcc accataatta ttgctatccc aacaggagtc aaagtattta gctgactagc      7200
     cactctgcac ggaggaaata ttaaatggtc tcccgctatg atatgagccc tgggctttat      7260
     ctttctgttt acagtaggag gccttacagg aattgtccta gctaactcat ctctagacat      7320
     cgttctccat gacacgtact atgtggtagc ccattttcac tatgtgctat caatgggagc      7380
     tgtttttgcc attatagggg ggtttgtcca ctgattccca ctattttcag gctacacgct      7440
     taataataca tgagcaaaaa ttcactttat aattatattc attggagtta acatgacatt      7500
     ctttcctcag cattttctag gcctgtcagg aatacctcgg cgatattccg actatcccga      7560
     tgcctacaca acatgaaata cagtatcttc tgtaggctca ttcatttcac taacagcagt      7620
     tatgctgata attttcatga tttgggaggc ctttgcatca aaacgagagg tggcagtagt      7680
     agaactcact tcaactaaca ttgaatgact tcatggatgc cctcctccat atcatacatt      7740
     cgaagaacct gcctacgtta tactaaaata agaaaggaag gagtcgaacc ctctggaatt      7800
     ggtttcaagc caatatcata accactatgt ctctctcaat aaagagatat tagtaaaaat      7860
     tacataactt tgtcagggtt aaattatagg tgaaaatcct ttatatcttt atggcatacc      7920
     ccttccaaat aggccttcaa gacgcaactt ctcctatcat agaggaactt ctacattttc      7980
     atgatcatac attaataatt gtattcctaa ttagctcact ggttctctat attatttcaa      8040
     ctatactaac caccaaacta acgcacacaa gtacaatgga cgcacaagaa gtagagacgg      8100
     tgtgaactat cctgccagct atcatcctga ttctgattgc actcccatca ctacggatcc      8160
     tctacatgat ggatgaaatc aataatccct cactaactgt aaaaaccata ggtcaccagt      8220
     gatattgaag ttacgagtat acagattatg aagacttaaa ctttgactct tatatgattc      8280
     cgacacaaga actaaagcct ggagaactgc ggctattaga agtagacaat cgagtagtgc      8340
     tgcccataga aataacgatc cgtatactga tctcgtcaga agatgtcttg cactcatgag      8400
     ctgtgccatc cctaggacta aaaactgacg caatcccagg acggctaaac cagacagctc      8460
     ttatagccat gcgaccaggg ctatattacg gccaatgctc agaaatttgt ggctccaatc      8520
     acagttttat gcccattgtc ctcgagctag tcccactatc ctattttgaa gaatggtccg      8580
     cctcagtact atagaatcat taagaagcta acacagcatt aaccttttaa gttaaagact      8640
     gagaatgcaa acttctcctt aatgaagatg ccacaactag atacatcaac atgatctatt      8700
     acaattctat ccatagttct aacattattt attattctcc agttaaaagt ctcaaaatat      8760
     aaatatcctg agattcccga gccgaaatcc ctcttatcat caaaaaaact tgtgccttga      8820
     gaagaaaaat gaacgaaaat ttatttacct cttttatcac cccaacgata atgggaattc      8880
     ctattgtact tttaattatt atatttccga gcattttatt tccttcttcc agtcgattga      8940
     tcgataatcg cctagtatct gttcaacagt gactagtccg gctaacatca aaacaaatat      9000
     tatccattca caaccacaag ggacaaacct gagcactaat attgatgtca ctaatcctat      9060
     ttattggctc aactaatctt ctgggtctat taccacactc attcacacct accacacagc      9120
     tgtcgatgaa cctaggaatg gctattccct tgtgggcagg tacagtcgct actggattcc      9180
     gatacaagac caaagcatcc ctggctcact ttctacctca aggaacacct ttccccttaa      9240
     tcccgatgct cgtaattatc gaaacaatca gcctatttat ccaacctatg gccttggccg      9300
     tgcgattaac cgctaatatt actgcaggtc atttactcat ccatctaatt gggggagcta      9360
     ctttggccct aacaagtatt agcactatta cagcctgtat cgccttcacc attctagtgc      9420
     tactcactat tctcgagttc gctgtagccc tcatccaggc ctacgtcttt accctgctag      9480
     taagtctata cttacacgat aacacttaat gactcaccaa acacatgcat atcatatagt      9540
     caatccaagc ccatgaccac taacaggagc cctttcagcc cttcttataa catcggggct      9600
     aattatatga tttcacttta actctatact cttgttatta ctaggtctta caaccaatat      9660
     acttaccatg tatcaatggt ggcgggacat tattcgagag agtacctttc agggccatca      9720
     cactcctgcc gtccaaaagg gactgcggta cggaatagtc ctatttatcg tatcggaagt      9780
     gttctttttc gcaggattct tctgggcttt ttaccactca agcctagcac ctactcccga      9840
     actaggagca tgctgaccac ccacaggtat tactccccta aatccgctag aagtgccact      9900
     tctcaacact tcagtacttc ttgcatccgg agtgtccatt acctgagctc accacagctt      9960
     aatagaggga aaccgcaagc acatactcca ggccctattc attactatct ctctaggcgt     10020
     atacttcaca ctcctgcaag cttcagagta ctatgaggca tcctttacca tttcagatgg     10080
     agtctatggc tcaacttttt tcatagcaac gggatttcac ggacttcatg taatcattgg     10140
     ctcaactttt ctcacagtct gtttcctacg acaactacac tttcacttca catcaagtca     10200
     ccatttcggc ttcgaagcag cagcatgata ttgacacttc gtagatgtcg tatgactatt     10260
     cctatatgtt tccatctatt gatgaggatc ttgcttcttt agtattgatc agtacaattg     10320
     acttccaatc aataagctct ggcgcagtcc agaaagaagc aatcaactta atcctagcac     10380
     tattcaccaa tatactacta gcttccctac tcgtccttat tgccttttgg ctaccacaat     10440
     taaatatcta cgcagagaaa gcaagcccct atgaatgcgg atttgacccc ataggatcgg     10500
     cacgtctccc tttttctatg aaattcttcc tggtagctat tacatttcta ctatttgatc     10560
     tagaaattgc actactcctc ccccttccct gagcatcaca aactgataat ctaataacaa     10620
     tactcaccat agcgctactg cttatctccc tactagccat gagtctggcc tatgaatgag     10680
     ctgaaaaagg tctagaatgg gccgaatatg ataattagtt taaaccaaaa caaatgattt     10740
     cgactcatta gattatgaat aacaacataa ttatcaaatg cctgtagtct atgtcaatat     10800
     tttcttagca ttcattgtat ccctaatagg actgctcatc tatcgatccc atctaatatc     10860
     ctccctgctt tgcctagagg gtatagcgct atccttattc gtcatgctta cagtaacagt     10920
     tttaaataac cacttcacac tggctaatat agccccaatt atcctgctgg tattcgctgc     10980
     ctgtgaagca gcactaggac tgtccctgcc agtaatagtt tctaacactt acggaactga     11040
     ctatgtacaa aacctcaatc tcttacaatg ctaaaaatta tctttcccac tataatatta     11100
     atacctctta catgagcatc aaaacccaat ataatttgga ttaacacaac agcttacagc     11160
     ctacttatta gtctcatcag tctgacgtac ctcaaccaac ttagtgataa tagcctaaac     11220
     ttctcattat tattctttac cgactcccta tcagcccctc tattagccct cacaacatga     11280
     ctactacctc taatactaat ggcgagtcaa ttccacctgt caaaggaaac tctgacccga     11340
     aagaaattat acatcactat actaatcctc ctacaattat tcctgatcat aaccttttct     11400
     gctatagagc tgatcctatt ctatatcttg ttcgaagcca ccctagtacc cactctagtt     11460
     attatcactc gatgaggaaa tcaaacagaa cgactaaacg cgggccttta ttttctattt     11520
     tacaccctag tggggtcttt accattacta attgccctac tacataccca aaataatcta     11580
     ggctccctaa actttctcat aatacaatac tgaatccagc ccctgccaaa ctcctgatcc     11640
     agtatctttc tatgactggc atgtataata gcatttatgg taaaaatacc tctatatggt     11700
     cttcacctgt gattaccaaa agcacacgta gaggcaccca ttgcaggatc catagtactt     11760
     gccgccgtac tcctaaaact aggaggctac ggcataatac gaattacaac attacttaat     11820
     cctttaacga gcttcatggc ttaccccttc ataatactct cgctatgggg tataattata     11880
     acaagttcta tctgcttacg ccaaacagat ttaaagtccc taatcgctta ctcctctgtc     11940
     agtcacatgg ccctagtcat tgtagcagta ttaatccaaa ccccatgaag ctatatagga     12000
     gcaacagcct taataattgc ccacggacta acgtcctcca tgctattctg tcttgcaaac     12060
     tccaactacg aacgaatcca tagccgaact ataatccttg cgcgaggcct acaaacactt     12120
     ctcccactta tggcagcttg gtgactacta gcaagtctca ctaatctagc actccccccc     12180
     accatcaacc ttatcggaga actatttgtg gtagtagcta cattttcatg gtctaacatc     12240
     accatcactc taataggaac taacattatc attactgccc tttactctct ctacatactg     12300
     atcaccacac aacgaggcaa gtgcacagac cacatcaaaa gtattaaacc atctttcaca     12360
     cgagaaaacg ccctaatagc tctccacctc ctaccccttc tgctactatc ccttaacccc     12420
     aaaataattc taggacccat ttactgtaaa tatagtttaa caaaaacatt agattgtgaa     12480
     tctaataata aaagccgaag tctttttatt taccgaaaaa gtacgcaaga actgctaact     12540
     catgcgtcca tgcataaaat catggctttt tcaactttta aaggatagaa gtaatccatt     12600
     ggtcttagga accaaaaaat tggtgcaact ccaaataaaa gtaatcaatc tatttacctc     12660
     ctctattatc ataactttgc tcatattaat gataccaatt atcctcacca gcacttcaac     12720
     acataaaaac aaattttatc cacaatatgt aaaaactaca gtctcttatg ctttcatagt     12780
     tagtactatt cccataatga tattccttta ctcagggcaa gagataatta tctcaaactg     12840
     acattgaata actattcaaa ccttaaaact aaccctaagc tttaagctag actatttctc     12900
     aataattttt atgccagtag ctctattcgt cacatgatcg atcatggaat tttctatttg     12960
     atacatacac actgacccca acatcagcca tttcttcaag tatctactca tattccttat     13020
     taccataata attttagtaa ccgcaaataa tctatttcaa ctattcatcg gctgagaggg     13080
     agtagggatc atatctttcc tccttattgg gtgatggtac ggacgaacag acgccaatac     13140
     agctgcccta caagcagtcc tatataatcg catcggagac gtaggcttta tcatagccat     13200
     agcctgattt ttactcaata cgaatgcatg agacttccaa caaatctttg caattgaaca     13260
     tgaaaacctt aacatcccac tagcaggact actcctagca gccactggaa aatcagccca     13320
     attcggcctt catccatgac tcccatcagc tatagaagga cctactcctg tttcagccct     13380
     actccactct agtactatag tagtagcggg ggtatttctt ctaatccgat tctacccctt     13440
     gatagaacac aacaagacta tccaaacagc cactttatgc ttaggagcaa taactaccct     13500
     atttacagca gcctgtgctc tcacccagaa tgatattaaa aagatcattg ccttttccac     13560
     ctcaagccag ctaggactaa taattgtaac aattggaatt aaccagcccc acctagcatt     13620
     ccttcatatc tgcacacacg catttttcaa ggccatacta ttcatatgct ctgggtccat     13680
     tatccacagc ctgaatgatg aacaagacat ccgaaaaata ggaggcctat tcaaagccct     13740
     accacttacc actaccgcac taattatcgg agctctagca cttacaggca tacctttcct     13800
     aacaggattc tactctaaag acctaattat cgaaaccgcc aacacgtcat acaccaacgc     13860
     ctgagcccta ctaacaactc tcattgctac atccataacc gctgcctaca gtactcgaat     13920
     cgtattcttc gtacttctag gacaaccccg ctttaaccct gtcatcgtta tcaacgagaa     13980
     tagccctctc ctaatcaact ccatcaaacg tctacttcta ggaagtattt tcgcaggata     14040
     cctaattttc cacaatatta cacccactac caccccacaa ataaccatac cccactatct     14100
     aaaaataata gctctcgcgg ttactatact aggttttatc ctagcattag aactcaattc     14160
     tatctcacaa actctcaaac ttgactaccc acaaaatcta ttcaaattct ctattcaact     14220
     aggatacttc cccattatta ttcaccgcct cctaccaata atgagcttat caataagcca     14280
     aaaaatggca tctatactac tagacataat ctgactagaa aatgcactac caaaatctat     14340
     ctcctatttc caaataaaat cttcaatcat agtctctaat cagaaaggat taattaaact     14400
     atattttctc tccttcatga tcacactaac cctaagcttc ttcgtactta atttccacga     14460
     gtgacttcca taattactaa cacaccaata agaagagacc acccagtgac aataactaat     14520
     caagttccat aactgtataa agccgcaatc cccatggctt cctcactaaa aaaccccgaa     14580
     tcccccgtgt cataaattac tcaatcacct atcccattaa atttgaacac aatctcaact     14640
     tcatcatcct ttaggacata acaggcaatc aatagctcag acaatagacc cacaataaat     14700
     gcacctaata cagctttatt agagacccag acctcagggt actgctcagt ggccatagcc     14760
     gtagtataac caaaaactac aagtatccca cccaaataaa ctaaaaaaac tattaaacct     14820
     aaaaaggatc ccccaaaatt caacacaatg ccacacccaa cacccccact aataattaaa     14880
     actaaccccc cgtagatggg agaaggctta gaagaaaacc ctacaaaacc catcacaaag     14940
     atagtactta aaataaacac gatatacatt atcattattc tcacatggag tctaaccatg     15000
     actagtgaca tgaaaaatca ccgttgtact tcaactacaa gaaccttaat gaccaacatc     15060
     cgaaaaaccc atccactagc taaaatcatc aacaactcat tcattgacct cccaacacca     15120
     tcaaacatct cagcatgatg aaactttgga tccctcctcg gagtatgctt agttctacag     15180
     atcctaacag gcctgtttct agctatacac tacacatcag acacaaccac agccttttca     15240
     tcaatcaccc atatttgccg agacgttcac tacggttgag ttatccgata catacatgca     15300
     aacggagcct ccatattctt tatctgccta ttcatgcacg taggacgggg cctatactat     15360
     ggctcatacc tattctcaga aacatgaaac attggcatta ttctcctact tacagtcata     15420
     gccaccgcat tcataggata tgtcctaccc tgaggccaaa tgtccttctg aggagcaact     15480
     gtcattacca atctactatc ggccattccc tacatcggaa cggacctagt agagtgaatc     15540
     tgaggaggct tttccgtaga taaggcaact ctaacacgat tctttgcctt ccactttatc     15600
     ctcccgttca tcatcctagc actagcagca gtccatctat tgtttctaca cgaaacagga     15660
     tccaacaacc cctctggaat cccatctaac tcagacaaaa tcccatttca cccatactat     15720
     acaattaagg acatcctagg cgccctgctt ctcaccctag ctttagcaac tctagtccta     15780
     ttctcgcctg acttactagg agaccctgac aactataccc ccgcaaaccc actaagtacc     15840
     ccaccccaca tcaaacccga gtggtacttt ctatttgcct acgctatcct acgatctatc     15900
     cctaacaaac taggaggagt actagcacta atcttctcca ttctaatcct agctatcatt     15960
     cctcttctac acacatccaa acaacgagga atgatattcc ggcctctaag ccaatgccta     16020
     ttctgactcc tagtagcaga cctactaaca ctaacatgaa ttggaggaca accagtagaa     16080
     caccccttca tcattatcgg acagctagcc tccattctct actttacaat cctcctagta     16140
     ctcataccca tcgctggaat tattgaaaac aacctcttaa agtgaagagt ctttgtagta     16200
     tagcaattac cttggtcttg taagccaaaa acggagaata tttaccctcc ctaagactca     16260
     aggaagaagc aacagctcca ctatcagcac ccaaagctga tgttctactt aaactattcc     16320
     ttggtacata ccattatttt actctacact ctatttattt catatatacc atctcatgta     16380
     ctgtaccatc atagtatgtc cttaaatact ttttccttta tttttttttt ccccccctat     16440
     gtatatcgtg cattaatggc gtgccccatg catataagca tgtacatatt atgcttggct     16500
     ttacatgagg acctacattt tgaaagttta tctcaagtgt atagtctgta agcatgtatt     16560
     tcacttagtc cgggagctta atcaccaggc ctcgagaaac cagcaaccct tgcgagtacg     16620
     tgtacctctt ctcgctccgg gcccataaaa tgtgggggtt tctatgttga aactatacct     16680
     ggcatctggt tcttacttca gggccatgat agctctagat tccaatccta ctaacccttc     16740
     aaatgggaca tctcgatgga ctaatgacta atcagcccat                           16780
//


spacer
spacer