spacer

EBI Dbfetch

ID   FM177759; SV 1; circular; genomic DNA; STD; MAM; 16893 BP.
XX
AC   FM177759;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Ursus thibetanus complete mitochondrial genome
XX
KW   complete genome.
XX
OS   Ursus thibetanus (Asiatic black bear)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ursus.
OG   Mitochondrion
XX
RN   [1]
RP   1-16893
RA   Krause J.;
RT   ;
RL   Submitted (23-JUN-2008) to the INSDC.
RL   Krause J., Evolutionary Genetics, Max Planck Institute, Deutscher Platz 6,
RL   04103 Leipzig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-220.
RX   PUBMED; 18662376.
RA   Krause J., Unger T., Nocon A., Malaspinas A.S., Kolokotronis S.O.,
RA   Stiller M., Soibelzon L., Spriggs H., Dear P.H., Briggs A.W., Bray S.C.E.,
RA   O'Brien S.J., Rabeder G., Matheus P., Cooper A., Slatkin M., Paabo S.,
RA   Hofreiter M.;
RT   "Mitochondrial genomes reveal an explosive radiation of extinct and extant
RT   bears near the Miocene-Pliocene boundary";
RL   BMC Evol. Biol. 8:220-220(2008).
XX
DR   MD5; 945b9f14690365b49ac9b5ad51c307d0.
DR   EuropePMC; PMC2518930; 18662376.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16893
FT                   /organism="Ursus thibetanus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9642"
FT   D-loop          join(1..989,16438..16893)
FT   repeat_region   220..659
FT                   /rpt_type=TANDEM
FT                   /note="microsatellite"
FT   tRNA            990..1057
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT   rRNA            1058..2023
FT                   /gene="12S rRNA"
FT                   /product="12S ribosomal RNA"
FT   tRNA            2024..2089
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT   rRNA            2090..3671
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            3672..3746
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             3749..4704
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:4703..4704,aa:TERM)
FT                   /gene="NADH1"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8E5"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8E5"
FT                   /protein_id="CAQ68404.1"
FT                   /translation="MFMINTISLVVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGL
FT                   LQPVADAVKLFTKEPLRPLTSSATMFIMAPILALTLALTMWIPLPMPYPLVNMNLGVLF
FT                   MLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFALS
FT                   TLITTQEHLWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAL
FT                   FFLAEYTNIIMMNALTTILFFGAFHNPYMPELYTVNFTVKTLLLTASFLWIRASYPRFR
FT                   YDQLMHLLWKNFLPLTLALCMWHVTLPIITASIPPQM"
FT   tRNA            4705..4773
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            complement(4771..4843)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            4845..4913
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT   CDS             4914..5955
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:5955,aa:TERM)
FT                   /gene="NADH2"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8E6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8E6"
FT                   /protein_id="CAQ68405.1"
FT                   /translation="MKPPILIIITSTIALGTMIVLFSSHWLMIWVGFEMNMLAIIPILM
FT                   KKFNPRAMEASTKYFLTQATASMLLMLGIIINLLHSGHWTISMIPNPIASTVITIALAM
FT                   KLGLSPFHFWVPEVTQGVPLSSGMILLTWQKIAPLSVLYQISPSINPNLLMAMAATSVL
FT                   VGGWGGLNQTQLRKILAYSSIAHMGWMAAIMVYNPTLMILNLAIYIMMTLGTFMLFMHS
FT                   LSTTTLSLSHTWNKSPLIASLILALMLSLGGLPPLSGFIPKWMIIQELTKNDMIVMPTF
FT                   MAITALLNLYFYMRLTYATALTMFPSANNMKMKWQFESTKKMILLPPLIVASTMLLPLT
FT                   PLLSIMD"
FT   tRNA            5956..6022
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT   tRNA            complement(6031..6099)
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT   tRNA            complement(6100..6172)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(6206..6272)
FT                   /gene="tRNA-Cys"
FT                   /product="transfer RNA-Cys"
FT   tRNA            complement(6273..6339)
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   CDS             6341..7885
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxI"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="GOA:B5B8E7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8E7"
FT                   /protein_id="CAQ68406.1"
FT                   /translation="MFMNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPG
FT                   TLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAIN
FT                   FITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMW
FT                   ALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL
FT                   FSGYTLNNTWAKIHFMIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTVSSMGS
FT                   FISLTAVMLMIFMTWEAFASKREVAVVELTSTNIEWLHGCPPPYHTFEEPAYVTLK"
FT   tRNA            complement(7883..7951)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            7958..8024
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT   CDS             8025..8708
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="coxII"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="GOA:A8QW60"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:A8QW60"
FT                   /protein_id="CAQ68407.1"
FT                   /translation="MAYPLQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISIM
FT                   LTAKLTHTNTMDAQEVETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQW
FT                   YWSYEYTDYEDLSFDSYMTPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPIVLELVPLSYFEKW
FT                   SASML"
FT   tRNA            8712..8779
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT   CDS             8782..8985
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="atp8"
FT                   /product="ATP synthase F0 subunit 8"
FT                   /db_xref="GOA:B5B8E9"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8E9"
FT                   /protein_id="CAQ68408.1"
FT                   /translation="MPQLDTSTWSITILSMVLALFIMFQLKISKYKYPETPEPKSLSSS
FT                   KKLMPWEEKWTKIYSPLLLPRW"
FT   CDS             8943..9622
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:9621..9622,aa:TERM)
FT                   /gene="atp6"
FT                   /product="ATP synthase F0 subunit 6"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F0"
FT                   /protein_id="CAQ68409.1"
FT                   /translation="MNENLFTSFITPMMMGIPIVVLIVMFPSILFPSPSRLIDNRLVSI
FT                   QQWLVRLTSKQMLSVHNRKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGM
FT                   AIPLWAGTVATGFRYKTKASLAHFLPQGTPFPLIPMLVIIETISLFIQPMALAVRLTAN
FT                   ITAGHLLIHLIGGATLALTNISTITALITFIILVLLTILEFAVALIQAYVFTLLVSLYL
FT                   HDNT"
FT   CDS             9623..10406
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10406,aa:TERM)
FT                   /gene="coxIII"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F1"
FT                   /protein_id="CAQ68410.1"
FT                   /translation="MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSMFLLSL
FT                   GLTTNMLTMYQWWRDIIRESTFQGHHTPVVQKGLRYGMVLFIVSEVFFFAGFFWAFYHS
FT                   SLAPTPELGACWPPAGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGSRKHMLQAL
FT                   LITISLGVYFTLLQASEYYEASFTISDGVYGSTFFMATGFHGLHVIIGSTFLTVCFLRQ
FT                   LHFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
FT   tRNA            10407..10475
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT   CDS             10476..10822
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:10821..10822,aa:TERM)
FT                   /gene="NADH3"
FT                   /product="NADH dehydrogenase subunit 3"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F2"
FT                   /protein_id="CAQ68411.1"
FT                   /translation="MNLILALFTNTLLASLLVLIAFWLPQSNIYAEKASPYECGFDPVG
FT                   SARLPFSMKFFLVAVTFLLFDLEIALLLPLPWASQTDNLMTMLITALLLISLLAASLAY
FT                   EWAEKGLEWAE"
FT   tRNA            10823..10891
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT   CDS             10892..11188
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH4L"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /db_xref="GOA:B5B8F3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F3"
FT                   /protein_id="CAQ68412.1"
FT                   /translation="MPVVYVNIFLAFIVSLTGLLIYRSHLMSSLLCLEGMMLSLFVMLT
FT                   VTVLNNHFTLANMAPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC"
FT   CDS             11182..12559
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:12559,aa:TERM)
FT                   /gene="NADH4"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:B5B8F4"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F4"
FT                   /protein_id="CAQ68413.1"
FT                   /translation="MLKIIFPTMMLVPLTWASKPNMIWINTTAYSLLICLISLTYFNQL
FT                   SDNSLNFSLLFFTDSLSAPLLALTTWLLPLMLMASQSHLSKETLTRKKLYITMLILLQL
FT                   FLIMTFSAMELILFYILFEATLMPTLVIITRWGNQTERLNAGLYFLFYTLAGSLPLLVA
FT                   LLHTQNNLGTLNFLMMQYWIQPLPNSWSSVFLWLACMMAFMVKMPLYGLHLWLPKAHVE
FT                   APIAGSMVLAAVLLKLGGYGMMRITTLLGPLTSFMAYPFMMLSLWGMIMTSSICLRQTD
FT                   LKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMVAHGLTSSMLFCLANSNYERVHSR
FT                   TMILARGLQTLLPLMAAWWLLASLTNLALPPTINLIGELFVVVATFSWSNITITLMGAN
FT                   IIITALYSLYMLITTQRGKCTDHIKSIKPSFTRENALMALHLLPLLLLSLNPKMILGPI
FT                   Y"
FT   tRNA            12560..12628
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT   tRNA            12629..12687
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            12688..12757
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT   CDS             12758..14578
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH5"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="GOA:B5B8F5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F5"
FT                   /protein_id="CAQ68414.1"
FT                   /translation="MNLFASSIITTLLMLTMPIILTGASTHKNKFYPQYVKTTISYAFA
FT                   VSTVPMMMFLYSGQEMIISNWHWMTIQTLKLTLSFKLDHFSMIFMPVALFVTWSIMEFS
FT                   IWYMHTDPNINRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAVLYNRIGDVGFIMAMAWFLLNTNAWDFQQIFAIERDNLNIPLAGLLLAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFHPLMEHNKTIQTAALCLG
FT                   AMTTLFTAACALTQNDIKKIIAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLF
FT                   MCSGSIIHSLNDEQDIRKMGGLFKVLPFTTTALIIGTLALTGMPFLTGFYSKDLIIETA
FT                   NTSYANAWALLMTLVATSMTAAYSARIVFFALLGQPRFSPAIIINENNPLLVNSIKRLL
FT                   LGSIFAGYLIFHNITPTTIPQMTMPYYLKTTALAVTMLGFILALELNTTMQSLKFNYPQ
FT                   NVFKFSNQLGYFPIIIHRFLPTMSLSMSQKMASMLLDTIWLETVLPKSISYFQMKSSIT
FT                   VSNQKGLIKLYFLSFMITLTLSFLVLNFHE"
FT   CDS             complement(14562..15089)
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="NADH6"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /db_xref="GOA:B5B8F6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F6"
FT                   /protein_id="CAQ68415.1"
FT                   /translation="MMMYIVFILSIVFVMSFVGFSSKPSPIYGGLVLIISGGVGCGIVL
FT                   SFGGSFLGLMVFLVYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLGAFIVGLLSELLIA
FT                   CYVLKDDEVEIVFKFNGVGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLI
FT                   GVLVIMEVTRGN"
FT   tRNA            complement(15090..15158)
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT   CDS             15163..16302
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B5B8F7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B5B8F7"
FT                   /protein_id="CAQ68416.1"
FT                   /translation="MTNTRKTHPLAKIINNSLIDLPAPSNISAWWNFGSLLGVCLILQI
FT                   LTGLFLAMHYTSDATTAFSSVAHICRDVHYGWIIRYMHANGASMFFICLFMHVGRGLYY
FT                   GSYLLSETWNIGIILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIILALAAVHLLFLHETGSNNPSGIPSDSDKIPFHP
FT                   YYTIKDALGALLLILALATLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIFSILILTIIPLLHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGG
FT                   QPVEHPFTIIGQLASILYFTILLVLMPIAGIIENNLSKW"
FT   tRNA            16303..16372
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(16372..16437)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
XX
SQ   Sequence 16893 BP; 5239 A; 4298 C; 2637 G; 4719 T; 0 other;
     gatcacacat aactgtggtg tcatgcattt ggtatctttt aatttttagg gggggaactt        60
     gctatgactc agctatgacc gtaaaggtct cgtcgcagtc aaataacttg tagctgggct       120
     tatttatctt tcacgggtcg ggcatagata cccataaggg gttactcagt caatggttac       180
     gggacatata gtatgtaaat accgctgaat cgagcgaaca cgcatgtgta cgcatgtgta       240
     cgcatgtgta cgcatgtgta cgcatgtgta cgcatgtgta cgcatgtgta cgcatgtgta       300
     cgcatgtgta cgcatgtgta cgcatgtgta cgcacgtgta cgcacgtgta cgcacgtgta       360
     cgcatgtgta cgcatgtgta cgcatgtgta cgcatgtgta cgcacgtgta cgcacgtgta       420
     cgcatgtgta cgcacgtgta cgcatgtgta cgcacgtgta cgcacgtgta cgcacgtgta       480
     cgcacgtgta cgcacgtgta cgcacgtgta cgcacgtgta cgcacgtgta cgcacgtgta       540
     cgcacgtgta cgcacgtgta cgcatgtgta cgcacgtgta cgcatgtgta cgcacgtgta       600
     cgcacgtgta cgcatgtgta cgcacgtgta cgcacgtgta cgcatgtgta cgcacgcgtt       660
     tttagatatt aacttagctt aatcaaaccc cccttacccc ccgtaacttc aaggagctta       720
     cgcacattta tgatcgtcct gccaaacccc aaaaacaaga ctaaatgcac gtgcaaacat       780
     gaagctatta cacccaaaat cccacataat aagctaaaat tcccagccaa ataatcacta       840
     caatcacagg catgagactt taaattaaga tctatctata gatatttttt ttttactctg       900
     tctccctcct attgattttt ccgctattat cacttttttg gccacgagct tctactaaat       960
     tatcccatat aaatcccaaa accaaccgcg tttatgtagc ttaataataa agcaaggcac      1020
     tgaaaatgcc tagacgagtt gtataacccc ataaacataa aggtttggtc ctagccttcc      1080
     cattagctat taacaagatt acacatgtaa gtctccgcgc tccagtgaaa atgccctttg      1140
     gatcttaaag cgatctgaag gagcgggcat caagcacacc cctccccggt agcttataac      1200
     gccttgctca gccacacccc cacgggatac agcagtgata aaaattaagc catgaacgaa      1260
     agtttgacta agctatgttg attaaagggt tggttaattt cgtgccagcc accgcggtta      1320
     tacgattgac ccgagttaat aggcccacgg cgtaaagcgt gtgaaagaaa aaatttttcc      1380
     ccattaaagt taaagtttaa tcaagctgta aaaagctacc aataacacta aaatagacta      1440
     cgaaagtgac tttaatactc tcaaccacac gacagctaag actcaaactg ggattagata      1500
     ccccactatg cttagcctta aacataaata atttatcaaa caaaattatt cgccagagaa      1560
     ctactagcaa cagcttaaaa ctcaaaggac ttggcggtgc tttaaacccc cctagaggag      1620
     cctgttctgt aatcgataaa ccccgataga cctcaccacc ccttgctaat ccagtctata      1680
     taccgccatc ttcagcaaac ccttaaaagg aaaaagagta agcacaatca tcttgcataa      1740
     aaaagttagg tcaaggtgta acccatggga tgggaagaaa tgggctacat tttctattca      1800
     agaacaacct acgaaagttt ttatgaaact aaaaactaaa ggtggattta gtagtaaacc      1860
     aagaatagag agcttggttg aataaggcaa tgaagcacgc acacaccgcc cgtcaccctc      1920
     ctcaagtggc acaagtcaaa tacaacctat taaaaccaaa taaaacgcaa gaggagacaa      1980
     gtcgtaacaa ggtaagcgta ctggaaagtg tgcttggata aaccaaagtg tagcttaaac      2040
     aaagtatctg gcttacaccc agaagatttc acgtatgtga ccgctttgag cccagagcta      2100
     gcccagacaa taaccaatca aactaccaca ggccaattaa ataaaacatt cagtagtgca      2160
     attaaagtat aggagataga aattctttag atcggagcta tagagaaagt accgcaaggg      2220
     aatgatgaaa gattacccaa agtgataaac agcaaagatt accccttcta ccttttgcat      2280
     aatgagttag ccagaaataa cctaacaaag agaacttaag ctaggtcccc cgaaaccaga      2340
     cgagctacct atgaacaatc cattggggta aactcatcta tgttgcaaaa tagtgagaag      2400
     atttgtaggt agaggtgaaa agcctaacga gcctggtgat agctggttgc ccagaataga      2460
     acttcagttc aactttaaac ttgcctacaa aacttagata attttaatgc aagtttaaaa      2520
     tatattctaa aaaggtacag ctttttagaa tcaaggatac aaccttactt agagagtaaa      2580
     tactgattaa accatagtag gcctagaagc agccatcaat taagaaagcg tttaagctca      2640
     acatccatgt caacttaata ccaaaagtat ttaatcaact cctaatataa caactgggct      2700
     aatctatttt aatatagaag caataatgct aatatgagta acgagagata cctctccaac      2760
     gcataagcct ataacagcaa cggataacca ctgatagtta acaacaacgt agaaataatc      2820
     caacaataaa acatctacca aaccaattgt taatccaaca caggtatgcg actaaggaaa      2880
     gattaaaaga agtaaaagga actcggcaaa cacaaatccc gcctgtttac caaaaacatc      2940
     acctccagca ttcccagtat tggaggcact gcctgcccgg tgacattagt taaacggccg      3000
     cggtattctg accgtgcaaa ggtagcataa tcatttgttc tctaaataag gacttgtatg      3060
     aaaggccaca cgagggttta actgtctctt acttccaatc agtgaaattg accttcccgt      3120
     gaagaggcgg gaataaaaca ataagacgag aagaccctat ggagctttaa ttaactagct      3180
     caaaagaatc tatctaccaa accaacagga acaacatact ccttccatga gctaacaatt      3240
     taggttgggg cgacctcgga gcataaaata acctccgagt gatattaatc tagacgtacc      3300
     agtcaaaatg ctcacttact tattgatcca aaaacctctt tgatcaacgg aacaagttac      3360
     cctagggata acagcgcaat cctatttaag agtccatatc gacaataggg tttacgacct      3420
     cgatgttgga tcaggacatc ctaatggtgc agcagctatt aagggttcgt ttgttcaacg      3480
     attaaagtcc tacgtgatct gagttcagac cggagcaatc caggtcggtt tctatctatt      3540
     taaacaacct ctcccggtac gaaaggacaa gagaagtaag gcctccctca ctgaggcgcc      3600
     ttaagaccaa tagatgatct aatctaaatc tagtaagtct atccccaata ctgcccaaga      3660
     gacagggctt tgttagggtg gcagagcccg gtgactgcat aaaacttaaa cttttatatt      3720
     cagaggttca aatcctctcc ccaacattat gtttataatc aacactatct cactagttgt      3780
     acccattctc cttgccgtag ccttcttaac actagtagag cgaaaagtac taggctatat      3840
     acaacttcgt aaaggaccaa acattgtagg gccctatggt ctcctacaac ctgtcgcaga      3900
     tgctgtaaaa cttttcacca aagagcctct acgtccactc acatcatctg cgactatatt      3960
     cattatagcc cctattctgg ctctaacact agccctaacc atgtgaattc ccctaccaat      4020
     gccatatccc cttgtcaata taaacctcgg agtactattc atactagcaa tatcaagcct      4080
     agctgtatac tctatccttt gatcaggatg agcttcaaat tcaaaatacg ctctgatcgg      4140
     agccctacgg gccgtagccc agacaatttc atatgaagtc acattagcca ttatcctcct      4200
     atcagtccta ctaatgaatg gctcattcgc actttccact ttaattacta ctcaagagca      4260
     cctctgacta atcttccctg catgacccct agccatgata tgatttattt ccaccctagc      4320
     agaaactaac cgagccccct tcgacctaac agaaggagaa tcagaactag tctcaggttt      4380
     taacgttgaa tacgcagcag gtccgttcgc cctatttttc ctagcagaat atactaatat      4440
     tattataata aatgccctca cgactatcct gttcttcggg gcatttcaca acccctacat      4500
     accagaactg tacactgtca acttcaccgt gaaaacacta ctcttaacag cttccttcct      4560
     atgaatccgt gcatcatatc cccgatttcg atacgaccaa ctaatacatc tgctatgaaa      4620
     aaacttccta ccccttacgc tagccctgtg catgtgacat gtaacactac ccattatcac      4680
     agcgagcatt cctccccaaa tataagaaat atgtctgata aaagaattac tttgatagag      4740
     taaataatag aggttagaat cctcttattt ctagaattat aggaattgaa cctaatccta      4800
     agaactcaaa aatcttcgtg ctacctaatt acaccatatc ctaaagtaag gtcagctaaa      4860
     taagctatcg ggcccatacc ccgaaaatgt tggtttatcc ccttcccgta ctaataaaac      4920
     ctcccattct tatcattatc acatccacca ttgccctagg aaccatgatc gttttattta      4980
     gctcccactg actcataatc tgagtcggct ttgaaataaa tatactagct attatcccaa      5040
     tcctaatgaa aaaatttaac ccacgagcca tagaagcctc tacaaaatat ttcctcacac      5100
     aagccactgc atccatgctt ctaatactag gcattattat caatctacta cactcagggc      5160
     actgaacaat ctcaataatc cctaacccaa tcgcatcgac cgtaattact attgccctgg      5220
     caataaaact cggcctatcc cccttccact tctgagtccc agaagtcaca caaggcgttc      5280
     ctttatcctc aggaataatt ctactaacat gacaaaaaat cgcacctcta tccgtcttat      5340
     atcaaatctc accatccatc aacccaaacc tactgatagc aatagccgct acatccgtat      5400
     tagtaggggg ctgaggggga ctaaaccaaa ctcaacttcg aaaaatccta gcatactctt      5460
     caatcgctca catgggctga atagccgcca tcatagtata taaccccact ctaataatcc      5520
     ttaaccttgc aatctatatc ataataactc tggggacatt tatactattt atacacagcc      5580
     tatccacaac aacactatca ctgtcccata catgaaataa atcaccacta attgcctcac      5640
     taatcctagc acttatatta tcactaggtg gcctccctcc cctctcaggc ttcatcccca      5700
     aatgaataat cattcaagaa ctgacaaaaa atgatataat cgtcatgccc acattcatag      5760
     ccatcacagc cctactaaat ctttattttt acatacgtct aacatacgcc acagcattaa      5820
     caatattccc ctcagcaaat aacataaaaa taaaatgaca gtttgaaagc acaaaaaaaa      5880
     taattctctt gccccctcta atcgtagcat caaccatact cctcccacta actccattac      5940
     tatcaatcat ggactagaga tttaggctaa aaagaccaag ggccttcaaa gccctaagta      6000
     agtgagaccc acttaatctc tgcaattatc taaggactgc aagaacatat ctcacatcaa      6060
     ttgaacgcaa aacaaccgct ttaattaagc taagccctcc tagatcggtg ggcttttatc      6120
     ccacaaaatt ttagttaaca gctaaaaacc ccaaacaact ggcttcaatc tacttctccc      6180
     gccgcgtggg aaaaaaaggc gggagaagcc ccggcagaat tgaatctgct tctttgaatt      6240
     tgcaattcaa tatgattatt caccacagag cttggcaaaa aggggactca acctctattc      6300
     ttagatttac agtctagtgc ttttatcagc cattttacct atgttcataa accgatgact      6360
     attctctaca aatcataaag atattggcac tctctatctt ctattcggtg catgagccgg      6420
     aatagtgggt actgctctca gccttttgat ccgtgccgaa ctaggtcagc ccgggaccct      6480
     gttgggggat gatcagatct acaatgtgat cgtaactgcc catgcattcg tgataatctt      6540
     ctttatggtt atgcctatta tgattggggg attcgggaat tgattagtgc ccttaataat      6600
     tggtgctcct gacatagcgt ttcctcgaat gaataacata agcttctgac tgctgccacc      6660
     atctttctta ttgcttctag cctcttctat agtagaagca ggtgcaggaa ctgggtggac      6720
     tgtctacccc cctctagcgg gcaatctggc tcatgcagga gcatcagtag acctaacaat      6780
     cttttctcta cacttagcag gcatctcttc tattctggga gccatcaatt tcatcactac      6840
     tatcattaac atgaaacctc ctgcaatatc tcaataccaa acccctctgt ttgtatgatc      6900
     agtcctaatc acggcagtgc ttcttctttt atctctgcca gtcttggcgg ctggaattac      6960
     catactactt acagatcgaa atcttaacac tacctttttt gacccagccg gagggggaga      7020
     tcctattctg taccaacact tgttttgatt cttcggacac cctgaagttt atatcctgat      7080
     tcttccaggg ttcggaatga tctctcacat tgtcacttat tactcaggaa aaaaagagcc      7140
     tttcggctac atgggtatag tctgagcgat aatatctatt ggattcttag gatttatcgt      7200
     gtgagctcac catatgttta ccgtaggtat agatgtcgac acacgagctt acttcacttc      7260
     agctactata attattgcaa tcccaacagg agtcaaagta tttagctgac tagctaccct      7320
     gcacggaggg aatattaaat gatctcctgc tataatatga gccctaggct ttatttttct      7380
     atttacagtg gggggcctta caggaattgt cctagctaat tcgtctttag acattgttct      7440
     ccatgacaca tattatgtgg tagcccattt ccactatgtg ctgtcaatag gagctgtctt      7500
     tgccattata gggggatttg tccactgatt tccactgttt tcaggctata cacttaataa      7560
     tacatgagca aagattcact tcataatcat attcgttggg gttaatataa ctttctttcc      7620
     ccagcatttc ctaggcctgt cgggaatacc tcggcgatat tccgactatc cagatgccta      7680
     cacaatatga aatacagtat cttctatagg ctcattcatt tcactaacag cagttatact      7740
     aataattttc atgacttggg aggcttttgc atcaaagcga gaggtagcag tggtagaact      7800
     cacttcaacc aatattgaat gactacatgg atgtcctcct ccatatcata catttgaaga      7860
     acccgcttac gttacactaa aataagaaag gaaggaatcg aaccctctgg aattggtttc      7920
     aagccaatat cataaccact atgcctctct caataaagag atattagtaa aaattacata      7980
     actttgtcag ggttaaatta taggtgaaaa tcctttatat ctttatggca tatccccttc      8040
     aaataggtct tcaagacgca acttctccta tcatggagga actcctgcat tttcatgacc      8100
     atacactaat aattgtattc ctaattagct ccttagttct ctatattatt tcaattatat      8160
     taactgccaa attaacacac acaaatacaa tagatgcaca agaagtagag acggtatgaa      8220
     ccatcttgcc ggctattatc ctaattctaa ttgcactccc atcgctacgg attctttata      8280
     taatagatga aatcaataac ccctcactga ccgtaaaaac catgggccat cagtgatatt      8340
     gaagttacga gtatacagat tacgaagatc tgagctttga ctcttatata accccaacac      8400
     aagaactaaa acctggagag ctgcgactat tagaagtgga caatcgagta gtactgccca      8460
     tagaaataac gatccgtatg ctaatctcat cagaagatgt cttgcactca tgggctgtgc      8520
     catccctagg attaaaaact gatgcaatcc caggacggct aaaccaaaca actctcatag      8580
     ctatgcgacc aggattatat tacggccaat gctcagaaat ttgtggctcc aatcacagtt      8640
     ttatacctat tgttctcgag ctagttccac tatcttactt tgaaaaatgg tctgcctcga      8700
     tactatagaa tcattaagaa gctaatatag cgttaacctt ttaagttaaa gactgaggat      8760
     gcaaacttct ccttaatgaa gatgccacaa ctagatacat caacatgatc tatcacaatc      8820
     ctatctatag ttctagcact atttattata ttccagttaa aaatctcaaa atataaatac      8880
     cccgaaaccc ccgaaccgaa atctctttca tcatcaaaaa aacttatgcc ttgagaagaa      8940
     aaatgaacga aaatctattc acctctttta ttaccccgat gataatggga attcccattg      9000
     tagtcttaat cgttatgttt ccgagcattt tattcccttc tcccagtcga ctgatcgata      9060
     atcgcttagt gtctattcaa caatgactag tccggctaac gtcaaaacaa atgctatccg      9120
     ttcataatcg taaaggacaa acctgagcac taatgttgat atccctaatc ctatttattg      9180
     gctcaactaa tcttctgggt ctattgccac actcattcac acctaccacg caactgtcaa      9240
     taaatctggg aatggccatt cccttgtgag caggtacagt tgctactgga tttcgataca      9300
     agaccaaagc atccttagct cactttctac ctcaaggaac accttttcct ctaatcccta      9360
     tacttgttat tatcgaaaca atcagtctat tcatccaacc tatggcctta gccgtacgat      9420
     taactgctaa tattactgca ggtcacttgc tcatccattt aattggaggg gctactctgg      9480
     ctctaacgaa tattagcact attacagccc tcatcacctt tattattcta gtgctactta      9540
     ctattctcga gttcgctgta gccctcattc aggcctacgt cttcaccctg ctagtaagcc      9600
     tatacttaca cgataacact taatgactca ccaaacacat gcatatcata tagttaaccc      9660
     aagtccatga ccactaacag gagccctttc agcccttctt ataacatcag gattaatcat      9720
     atgattccac tttaactcta tattcttgct atcgctaggc cttacaacca acatacttac      9780
     tatataccaa tgatggcggg atattattcg agagagtacc tttcagggtc atcacacccc      9840
     cgttgtccaa aaaggactgc gatacggaat agtcctattt atcgtatcag aagtattctt      9900
     cttcgcaggg ttcttctgag ccttttatca ttcaagccta gcacccactc ccgaactagg      9960
     ggcatgctgg ccacccgcag gtattactcc cctgaacccg ctagaagtac cacttctcaa     10020
     tacttcagta cttcttgcat ccggagtgtc cattacctga gctcaccaca gcttaataga     10080
     gggaagccgt aagcacatgc ttcaggccct acttattacc atctctctag gcgtgtactt     10140
     cacacttcta caagcctcag agtattatga ggcgtccttc actatctcag atggagttta     10200
     tggctcaact ttcttcatag cgactggatt tcacggactt catgtaatta ttggctcaac     10260
     ttttctcaca gtctgtttcc tacggcaact acattttcat tttacatcaa gtcaccattt     10320
     cggctttgaa gcagcagcat gatattgaca cttcgtagat gtcgtatgac tattcctata     10380
     tgtttctatc tattgatgag ggtcttgctt ctttagtatc gatcagtaca attgacttcc     10440
     aatcaattag ctctggtgta atccagaaag aaacaatcaa cttaatccta gcactattta     10500
     ctaacacact actagcctcc ttactcgttc ttattgcctt ctgactacca caatcaaata     10560
     tctacgcaga gaaagcaagc ccctatgaat gcgggtttga ccccgtagga tcggcacgcc     10620
     tccctttttc aataaaattt ttcctagtag ctgtcacatt tctactattt gacctagaaa     10680
     ttgcgctact cctccccctt ccctgagcat cacaaactga caatctaata acgatactca     10740
     tcacagcact actgcttatc tccctattag ccgcaagtct ggcctatgaa tgagccgaaa     10800
     aaggtctaga atgggccgaa tatgataatt agtttaaacc aaaacaaatg atttcgactc     10860
     attagattat gaataatagc ataattatca aatgcctgta gtctatgtca atattttcct     10920
     agccttcatc gtatccctaa cagggctact tatttaccga tcgcatctaa tgtcctccct     10980
     actttgcctg gagggtataa tgctatcttt atttgtcata ctaacagtaa cagttttaaa     11040
     taaccatttt acactagcta acatagctcc cattatctta ctagtattcg ctgcctgcga     11100
     agcagcacta gggctatcct tgctagtaat agtctccaac acctatggaa ccgattacgt     11160
     acaaaacctt aatctcttac aatgctaaaa attatctttc ccactataat actagtaccc     11220
     cttacatgag catcaaaacc caatataatc tggattaata caacagctta cagcctactc     11280
     atttgtctta tcagcttgac atatttcaac cagctcagtg ataatagctt aaacttctca     11340
     ttattattct ttaccgactc cctatcagcc cccttactag ctcttacaac atgactactg     11400
     cctctgatac taatagcgag tcaatcccac ctatcaaagg agaccctgac ccgaaagaaa     11460
     ctatatatca ctatactaat cctcctacaa ctattcctga tcataacctt ttctgctata     11520
     gagctaatcc tgttctatat cttattcgaa gccaccctaa tacccactct agttattatt     11580
     actcgatggg ggaatcaaac agagcgatta aacgcgggcc tttactttct attttatact     11640
     ctagcaggat ctttaccact gctagttgca ctactacata ctcaaaacaa tctaggcacc     11700
     ctaaattttc tcataataca atactgaatc cagcccctgc caaactcctg atccagtgtt     11760
     ttcctgtgac tagcatgtat aatagcattc atagtaaaaa tacctctata cggccttcac     11820
     ttgtgattgc caaaagcaca tgtagaagcc cctatcgcag gatctatagt gcttgccgcc     11880
     gtactcctaa aactaggagg ctacggcatg atacgaatta caacactact tggcccttta     11940
     acaagcttca tggcctaccc cttcataata ctctcattat ggggcataat cataacaagt     12000
     tctatttgcc tacgccaaac ggatttaaag tccctaattg cttactcctc tgttagtcat     12060
     atagccctag tcattgtagc agtattgatc caaactccat gaagctatat aggagcaaca     12120
     gccctaatag ttgcccatgg actaacatcc tccatgctat tctgtcttgc aaactccaac     12180
     tatgaacgag tccatagccg aactataatc cttgcgcgag gcctacaaac actcctccca     12240
     cttatggcag cttgatgact actagcaagt cttactaatt tggcactccc tcctaccatc     12300
     aatctcatcg gagaactatt tgtggtagta gccacatttt catggtctaa catcaccatc     12360
     actctaatag gagccaacat catcattact gctctctatt ctctctacat actaatcacc     12420
     acacaacgag gcaagtgcac agatcatatc aaaagcatca agccatcctt cacacgagaa     12480
     aacgccctga tagctctcca cctcctaccc cttctacttc tatctctcaa ccccaaaata     12540
     attctaggac ccatttactg taaatatagt ttaacaaaaa cattagattg tgagtctaat     12600
     aataaaagcc caggcctttt tatttaccga aaaagtacgc aagaactgct aattcatgca     12660
     tccatgcata aaatcatggc tttttcaact tttaaaggat agaagtaatc cattggtctt     12720
     aggaaccaaa aaattggtgc aactccaaat aaaagtaatt aatctgtttg cttcctctat     12780
     tatcacaacc ttgctcatat taacgatacc aattatcctt accggcgctt caacacacaa     12840
     aaataaattc tacccacagt atgtaaaaac cacaatttcc tatgctttcg cagtcagcac     12900
     tgttcctata atgatattcc tctactcagg gcaagagata attatctcaa actgacattg     12960
     aataactatt caaaccctaa agctaactct aagctttaag ctagaccatt tctcgataat     13020
     ttttatacca gtagccctgt tcgtcacatg atccatcata gaattttcta tttgatatat     13080
     acacactgat cccaacatca accgattctt caaatatcta cttatattcc tcattactat     13140
     aataatttta gtaaccgcaa acaatctgtt ccaactattc atcggctgag aaggggtagg     13200
     aatcatatct ttcctcctta ttgggtgatg atacggacga acagatgcca atacagctgc     13260
     tctacaggca gtcttatata accgcatcgg agacgtaggc tttattatgg ctatggcctg     13320
     atttttactc aatacaaatg catgagactt ccaacaaatt tttgcaattg aacgtgacaa     13380
     ccttaatatc ccactagcag gactactcct agcagccact ggaaaatcag cccaattcgg     13440
     ccttcatcca tgacttccgt cagctataga aggacccacc cctgtttcag ccctactcca     13500
     ctccagtaca atagtagtag caggggtatt ccttctaatc cgatttcacc ccttaatgga     13560
     acataataag actatccaaa cagccgccct atgcttagga gcaataacaa ccctatttac     13620
     agcagcctgc gctctcaccc aaaatgatat taaaaagatt attgccttct ccacctcaag     13680
     ccaactagga ttaataatcg taacaattgg aattaaccaa ccccacttag catttcttca     13740
     tatctgcaca cacgcatttt tcaaagccat gctgtttata tgctctggat ctattatcca     13800
     cagtctaaat gacgaacaag acatccgaaa aataggaggc ctattcaaag tcctaccatt     13860
     taccaccact gcactaatta ttggaactct agcactcaca ggtatacctt tcctaacagg     13920
     attttactct aaagacctaa ttatcgagac cgccaatacg tcgtatgcca acgcctgagc     13980
     cctactaata actctcgtcg ccacatccat aaccgctgcc tacagtgctc gaatcgtatt     14040
     tttcgcactt ctaggacaac ctcgctttag ccctgctatt atcatcaacg agaataatcc     14100
     tctcttggtt aactccatca agcgtctact tctaggaagt atcttcgcag ggtacctaat     14160
     cttccacaat attacaccta ctaccatccc acaaataacc ataccctact atctaaaaac     14220
     aacagccctc gcggtcacta tactaggctt tatcctagca ctagaactta atactaccat     14280
     acaaagtctc aaatttaact atccacaaaa tgtattcaaa ttctccaatc aactagggta     14340
     cttccctatt attattcacc gcttcctacc aacaatgagc ctgtcaataa gccaaaagat     14400
     ggcatccatg ttactagaca caatctgact agaaactgta ttaccaaaat ccatctccta     14460
     cttccaaata aaatcttcaa tcaccgtctc caaccagaaa ggattaatca aactatattt     14520
     cctctctttc atgatcacac taaccctaag cttcctcgta cttaatttcc acgagtaact     14580
     tccataatta ctaatacacc gataagaaga gaccacccag taacaataac tagccaggtc     14640
     ccataactat acaaagccgc aatccccatg gcctcctcac taaaaaaccc tgaatccccc     14700
     gtgtcataaa ttacccaatc gcctacccca ttaaacttaa atacaatctc aacttcatca     14760
     tcttttagaa catagcaggc aatcagtaac tcagataata gacccacaat aaacgcacct     14820
     aatacagctt tattagaaac ccagacctca ggatattgct cggtagccat agctgtggta     14880
     taaccaaaaa ccacaagcat cccacccaaa taaactaaaa aaactattaa acctaaaaaa     14940
     gaccccccaa aactcaatac aataccacac ccaacacccc cactaataat taaaaccaat     15000
     cctccataaa taggagaagg cttagaagaa aaccccacaa aactcatcac aaagacaata     15060
     cttaaaataa acacgatata cattatcatt attctcgcat ggagtctaac catgactaat     15120
     gacatgaaaa atcaccgttg tacttcaact acaagaacct taatgaccaa cacccgaaaa     15180
     acccatccat tagccaaaat catcaacaac tcactcattg atctcccagc accatcaaat     15240
     atctcagcat gatgaaactt tgggtctctc ctcggagtat gcctaatcct acagattctg     15300
     acaggcctat ttctagctat acactacaca tcagacgcga ctacagcctt ttcatcagtc     15360
     gcccatattt gccgagacgt ccattatgga tgaattatcc gatatataca tgcaaacgga     15420
     gcctccatgt tcttcatctg cctattcata cacgtaggac ggggcttgta ttatggctca     15480
     tacctgctct cagaaacatg aaacattggc attatcctcc tatttacagt tatagccacc     15540
     gcattcatag gatacgtcct accctgaggc caaatatcct tctgaggagc gactgtcatt     15600
     accaacctcc tatcagccat cccctacatt ggaacggacc tagtagagtg aatctgagga     15660
     ggcttttccg tagataaagc aaccctaaca cgattctttg ctttccactt tatccttccg     15720
     tttatcatcc tagcactagc agcagttcat ctattgttcc tacacgaaac aggatccaac     15780
     aacccctctg gaatcccatc cgactcggac aaaatcccat tccatccata ctatacaatt     15840
     aaggacgccc taggcgccct acttctcatt ctagccctag caactctagt tctattctcg     15900
     cccgacttac taggagaccc tgacaactat acccccgcaa acccactgag cactccgccc     15960
     cacatcaagc ccgagtgata ctttttattt gcttacgcca tcctacggtc catccccaat     16020
     aaactaggag gagtgctagc gctaattttc tctatcctaa tcctaaccat tatccccctt     16080
     ctacacacat ccaaacaacg aggaataatg ttccgacccc taagccaatg cctattttga     16140
     ctcctagtag cagacctact aacactaaca tgaatcggag gacaaccagt agaacatccc     16200
     ttcaccatta ttggacagct agcctccatc ctctacttca caatcctcct ggtgctcatg     16260
     cccatcgctg gaatcattga aaacaacctc tcaaaatgaa gagtctttgt agtatagtaa     16320
     ttaccttggt cttgtaagcc aaaaacggag gatatttacc ctccccaaga ctcaaggaag     16380
     aagcaacagc cccaccatca gcacccaaag ctaatgttct atttaaacta ttccctggta     16440
     cataccatta ttttacttta tgccttattt atttcatata tatcatttca tgtactgtac     16500
     catcacagta tgttcttaaa tactttcttc tttgtttttt ttccccccct atgtatatcg     16560
     tgcattaatg gcgtgcccca tgcatataag catgtacata ttgtgcttgg ctttacatga     16620
     ggacttacgt tccagaaagt ttatttcagg tgtatagtct gtaagcatgt atttcactta     16680
     gtccgggagc ttagtcacca ggcctcgaga aaccagcaac ccttgcgagt acgtatacct     16740
     cttctcgctc cgggcccatg ggatgtgggg gtttctatgc tgaaactata cctggcatct     16800
     ggttcttacc tcagggccat gatagctcta gattccaatc ctactaaccc ttcaaatggg     16860
     acatctcgat ggactaatgg ctaatcagcc cat                                  16893
//


spacer
spacer