spacer

EBI Dbfetch

ID   FJ986467; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ986467;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0330 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Ong G., Lai C.-H.,
RA   Reinsmoen N.L.;
RT   "A New Variant of DRB1*0330 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Ong G., Lai C.-H.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (03-MAY-2009) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Health System, 8723 Alden Drive, SSB-197, Los Angeles, CA
RL   90048, USA
XX
DR   MD5; 6d93cafc8bf9f783f3117a2b0fcc8015.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0330"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0330"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0330"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C5J434"
FT                   /db_xref="IMGT/HLA:DRB1*03:43"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C5J434"
FT                   /protein_id="ACS15383.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0330"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 65 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer