spacer

EBI Dbfetch

ID   FJ986202; SV 1; linear; genomic DNA; STD; HUM; 2689 BP.
XX
AC   FJ986202;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   17-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1558 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2689
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2689
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 05df8eaf80e37908f57eb092bad3339f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2689
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2689
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1558"
FT   mRNA            join(<1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..>2689)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1558"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..2689)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1558"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5J406"
FT                   /db_xref="IMGT/HLA:B*15:58"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5J406"
FT                   /protein_id="ACS31821.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 2689 BP; 499 A; 802 C; 855 G; 533 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg aggatggcgc cccgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcctg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaaa ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggcct gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     aggcggagca gtggagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct aggatagtga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacatgtgac ccaccacccc atctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acaccgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcatat ctgttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcat cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      1980
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2040
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2100
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2160
     cagcatccac acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg      2220
     tgcagcacat gtgacaatga aggacagatg tatcgccttg atggttgtgg tgttggggtc      2280
     ctgattccag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2340
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgccc tgggtctgta      2400
     gtcatacttc tggaaattcc ttttggttcc aagacgagga ggttcctcta agatctcatg      2460
     gtcctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2520
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2580
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2640
     tccagccagc gacagtgccc agggctctga tgtgtctctc acagcttga                  2689
//


spacer
spacer