spacer

EBI Dbfetch

ID   FJ986197; SV 1; linear; genomic DNA; STD; HUM; 2688 BP.
XX
AC   FJ986197;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   17-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1513 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2688
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2688
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (05-MAY-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; a5d9251e2d32c20001b7845134141a39.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2688
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2688
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1513"
FT   mRNA            join(<1..73,202..471,717..992,1568..1843,1948..2064,
FT                   2506..2538,2645..>2688)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1513"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,717..992,1568..1843,1948..2064,
FT                   2506..2538,2645..2688)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1513"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q29911"
FT                   /db_xref="IMGT/HLA:B*15:13:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29911"
FT                   /protein_id="ACS31816.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRNTQISKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 2688 BP; 499 A; 802 C; 852 G; 535 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgtgggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacccgggg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatcg cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga ggatggcgcc ccgggcgcca tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatctc caagaccaac acacagactt       420
     accgagagaa cctgcggatc gcgctccgct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cccccctgag gccgcgggac ccgcccaaac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcggggccgg ggccagggtc       720
     tcacatcatc cagaggatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gtatgaccag tccgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc       840
     ctggaccgcg gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1200
     acagtcccta ggatagtgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1260
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1440
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1500
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1560
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      1860
     gggtcatatc tgttctcagg gaaagcagga gcccttctgg agcccttcag cagggtcagg      1920
     gcccctcatc ttcccctcct ttcccagagc catcttccca gtccaccatc cccatcgtgg      1980
     gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctactg      2040
     tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgggttttct      2100
     tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc      2160
     agcatcctca caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt      2220
     gcagcacatg tgacaatgaa ggacagatgt atcgccttga tggttgtggt gttggggtcc      2280
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2340
     gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgccct gggtctgtag      2400
     tcatacttct ggaaattcct tttggttcca agacgaggag gttcctctaa gatctcatgg      2460
     tcctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga aaaggaggga      2520
     gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct cacccacccc      2580
     ataattcctc ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt ttgttctact      2640
     ccagccagcg acagtgccca gggctctgat gtgtctctca cagcttga                   2688
//


spacer
spacer