spacer

EBI Dbfetch

ID   FJ985988; SV 1; linear; genomic DNA; STD; HUM; 1755 BP.
XX
AC   FJ985988;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*04010101 allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1755
RA   Lazaro A.M., Xiao Y., Nehlsen-Cannarella S.L., Fagoaga O.R., Hurley C.K.;
RT   "Novel hla class i allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1755
RA   Lazaro A.M., Xiao Y., Nehlsen-Cannarella S.L., Fagoaga O.R., Hurley C.K.;
RT   ;
RL   Submitted (04-MAY-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 8c726ddc77b7f58810366e65f63317b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1755
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00470"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1755
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT   mRNA            join(<1..270,517..792,1480..>1755)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1480..>1755)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5J3U3"
FT                   /db_xref="IMGT/HLA:C*04:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5J3U3"
FT                   /protein_id="ACR82517.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEAALRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT                   /number=3
FT   gap             793..1479
FT                   /estimated_length=687
FT   exon            1480..1755
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04010101"
FT                   /number=4
XX
SQ   Sequence 1755 BP; 172 A; 246 C; 288 G; 116 T; 933 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga      1500
     cccaccatcc cgtctctgac catgaggccg ccctgaggtg ctgggccctg ggcttctacc      1560
     ctgcggagat cacactgacc tggcagtggg atggggagga ccaaactcag gacaccgagc      1620
     ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct gtggtggtgc      1680
     cttctggaga agagcagaga tacacgtgcc atgttcagca cgaggggctg ccggagcccc      1740
     tcaccctgag atgga                                                       1755
//


spacer
spacer