spacer

EBI Dbfetch

ID   FJ985681; SV 1; linear; genomic DNA; STD; HUM; 1641 BP.
XX
AC   FJ985681;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   13-AUG-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1641
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   "A Novel HLA-B*35 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1641
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   ;
RL   Submitted (01-MAY-2009) to the INSDC.
RL   Pathology, All Children's Hospital, 801 6th Street South, St. Petersburg,
RL   FL 33704, USA
XX
DR   MD5; 1e82964215044426d7451b0b8e53a6fb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1641
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT   mRNA            join(<1..270,516..790,1365..>1641)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..790,1365..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5J3Q8"
FT                   /db_xref="IMGT/HLA:B*35:118"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5J3Q8"
FT                   /protein_id="ACR82905.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRAXPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /number=3
FT   gap             792..1365
FT                   /estimated_length=574
FT   exon            <1366..>1641
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /number=4
XX
SQ   Sequence 1641 BP; 179 A; 259 C; 272 G; 112 T; 819 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnacccc ccaaagacac      1380
     atgtgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1500
     ccgagcttgt ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg      1560
     tggtgccttc tggagaagag cagagataca catgccatgt acagcatgag gggctgccga      1620
     agcccctcac cctgagatgg g                                                1641
//


spacer
spacer