spacer

EBI Dbfetch

ID   FJ976695; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   FJ976695;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens clone BY00466 MHC class I antigen (HLA-A) gene, HLA-A*2601
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Xiao Y., Nehlsen-Cannarella S.L., Fagoaga O.R., Hurley C.K.;
RT   ;
RL   Submitted (24-APR-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; ac9d91dfbd357c9957dc4e51450dab3f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="BY00466"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5IZL3"
FT                   /db_xref="IMGT/HLA:A*26:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IZL3"
FT                   /protein_id="ACS12740.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGFQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601"
FT                   /number=3
XX
SQ   Sequence 787 BP; 109 A; 165 C; 197 G; 75 T; 241 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagag gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggttcc agcaggacgc ttacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggagacggcc catgaggcgg agcagtggag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer