Dbfetch

ID   FJ976693; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FJ976693;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens clone BY00464 MHC class II antigen (HLA-DPB1) gene,
DE   HLA-DPB1*010101 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Lazaro A.M., Xiao Y., Nehlsen-Cannarella S.L., Fagoaga O.R., Hurley C.K.;
RT   ;
RL   Submitted (24-APR-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; cf6d77d1c8584bcddd6335004c4ab657.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="BY00464"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*010101 variant"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*010101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*010101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*122:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="ACS12738.1"
FT                   /translation="NYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRR"
FT   exon            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*010101 variant"
FT                   /number=2
XX
SQ   Sequence 264 BP; 65 A; 63 C; 99 G; 37 T; 0 other;
     agaattacgt gtaccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt acgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//