spacer

EBI Dbfetch

ID   FJ976687; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   FJ976687;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens clone NT01063 MHC class I antigen (HLA-A) gene, HLA-A*68020101
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (24-APR-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 31cdcae1242ac5819a2bd6365cc26b7d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="NT01063"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68020101 variant"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68020101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68020101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5IZK6"
FT                   /db_xref="IMGT/HLA:A*68:48"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IZK6"
FT                   /protein_id="ACS12733.1"
FT                   /translation="SHSMRYFYTSMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGP
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKRKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68020101 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68020101 variant"
FT                   /number=3
XX
SQ   Sequence 787 BP; 111 A; 165 C; 195 G; 75 T; 241 other;
     gctcccactc catgaggtat ttctacacct ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagag gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcgcaagtg ggaggcggcc catgtggcgg agcagtggag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer