spacer

EBI Dbfetch

ID   FJ973631; SV 1; linear; genomic DNA; STD; HUM; 2689 BP.
XX
AC   FJ973631;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*1301 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2689
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, B, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2689
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (29-APR-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 18163a8cf7fa6a02ffdb1dfe27e3e605.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2689
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2689
FT                   /gene="HLA-B"
FT                   /allele="B*1301"
FT   mRNA            join(<1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..>2689)
FT                   /gene="HLA-B"
FT                   /allele="B*1301"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..2689)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="B*1301"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex class I"
FT                   /db_xref="GOA:C5IYE8"
FT                   /db_xref="IMGT/HLA:B*13:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IYE8"
FT                   /protein_id="ACR78568.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2689 BP; 502 A; 801 C; 851 G; 535 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggtgagtg cgggatcggg agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tctggcgggt       180
     ctcagcccct cctggccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggatggcgc cccgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga acctgcgcac cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac ggacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacatcat ccagaggatg tatggctgcg acctggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gttagcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagct caagtgggag gcggcccgtg       900
     tggcggagca gctgagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tgtaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcatat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcat cttcccctcc tttcccagag ccatcttccc agtccaccgt ccccatcgtg      1980
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctgct      2040
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2100
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2160
     cagcatgcac acaggggcta acgcagactg ggaccctgtg tgccagcact tactcttttg      2220
     tgcagcacat gtgacaatga agcacggatg tatcaccttg atggttgtgg tgttggggtc      2280
     ctgattccag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2340
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgccc tgggtctgta      2400
     gtcatacttc tggaaattcc ttttgggtcc aagactagga ggttcctcta agatctcatg      2460
     gccctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2520
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2580
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2640
     tccaggcagc gacagtgccc agggctctga tgtgtctctc acagcttga                  2689
//


spacer
spacer