spacer

EBI Dbfetch

ID   FJ973625; SV 2; linear; genomic DNA; STD; HUM; 2894 BP.
XX
AC   FJ973625;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   17-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw-Cw*0340 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2894
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Homo sapiens major histocompatibility complex class I, Cw, genomic
RT   sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-2894
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (28-APR-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2894
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (15-SEP-2009) to the INSDC.
RL   Immunogenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; e98cb9b8c9e112fc2f5ebb414425e331.
XX
CC   On Sep 15, 2009 this sequence version replaced gi:238928489.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2894
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2894
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*0340"
FT   mRNA            join(<1..73,204..473,719..994,1582..1857,1979..2098,
FT                   2538..2570,2678..2725,2890..>2894)
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*0340"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,719..994,1582..1857,1979..2098,
FT                   2538..2570,2678..2725,2890..2894)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*0340"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex class I"
FT                   /db_xref="GOA:C5IYE2"
FT                   /db_xref="IMGT/HLA:C*03:40:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IYE2"
FT                   /protein_id="ACR78562.2"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 2894 BP; 540 A; 825 C; 934 G; 595 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       540
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc ggggccaggg       720
     tctcacatca tccagaggat gtatggctgc gacgtggggc ccgacgggcg cctcctccgc       780
     gggtatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc       840
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac       960
     ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1020
     ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1080
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcctga gtttcctctg      1140
     agggccccct ctgctctcta ggacaattaa gggatgaagt ccttgaggaa atggagggga      1200
     agacagtccc tagaatactg atcaggggtc ccctttgacc actttgacca ctgcagcagc      1260
     tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcacgc tcaatgtgtt      1320
     tgaaggtttg attccagctt ttctgagtcc ttcggcctcc actcaggtca ggaccagaag      1380
     tcgctgttcc tccctcagag actagaactt tccaatgaat aggagattat cccaggtgcc      1440
     tgtgtccagg ctggcgtctg ggttctgtgc ccccttcccc accccaggtg tcctgtccgt      1500
     tctcaggatg gtcacatggg cgctgttgga gtgtcgcaag agagatacaa agtgtctgaa      1560
     ttttctgact cttcccgtca gaacacccaa agacacacgt gacccaccat cccgtctctg      1620
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1680
     cctggcagtg ggatggggag gaccaaactc aggacactga gcttgtggag accaggccag      1740
     caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga      1800
     gatacacgtg ccatgtgcag cacgaggggc tgccggagcc cctcaccctg agatggggta      1860
     aggaggggga tgaggggtga tgtgtcttct cagggaaagc agaagtcctg gagcccttca      1920
     gccaggtcag ggctgaggct tgggggtcag ggcccctcac cttcccctcc tttcccagag      1980
     ccgtcttccc agcccaccat ccccatcgtg ggcatcgttg ctggcctggc tgtcctggct      2040
     gtcctagctg tcctaggagc tgtggtggct gttgtgatgt gtaggaggaa gagctcaggt      2100
     agggaagggg tgaggagtgg ggtctgggtt ttcttgttcc actgggagtt tcaagcccca      2160
     ggtagaagtg tgccccacct cgttactgga agcaccatcc acacatgggc catcccagcc      2220
     tgggaccctg tgtgccagca cttactctgt tgtgaagcac atgacaatga aggacagatg      2280
     tatcaccttg atgattatgg tgttggggtc cttgattcca gcattcatga gtcaggggaa      2340
     ggtccctgct aaggacagac cttaggaggg cagttgctcc agaacccaca gctgctttcc      2400
     ccgtgtttcc tgatcctgcc ctgggtctgc agtcatagtt ctggaaactt ctcttgggtc      2460
     caagactagg aggttcccct aagatcgcat ggccctgact cctccctgtc ccctcacagg      2520
     gcattttctt cccacaggtg gaaaaggagg gagctgctct caggctgcgt gtaagtgatg      2580
     gcggtgggcg tgtggaggag ctcacccacc ccataattcc tcttgtccca catctcctgc      2640
     gggctctgac caggtctttt tttttgttct accccagcca gcaacagtgc ccagggctct      2700
     gatgagtctc tcatcgcttg taaaggtgag attctgggga gctgaagtgg tcgggggtgg      2760
     ggcagaggga aaaggcctag gtaatgggga tcctttgatt gggacgtttc gaatgtgtgg      2820
     tgagctgttc agagtgtgat cacttaccat gactgacctg aatttgttca tgactattgt      2880
     gttctgtagc ctga                                                        2894
//


spacer
spacer