spacer

EBI Dbfetch

ID   FJ969864; SV 1; linear; genomic DNA; STD; HUM; 2902 BP.
XX
AC   FJ969864;
XX
DT   07-JUN-2009 (Rel. 101, Created)
DT   07-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2407 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2902
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Genomic sequence of HLA Class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2902
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (28-APR-2009) to the INSDC.
RL   Immuongenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; a49f939f2ec5b4bba550f4163a33b5fe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2902
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2902
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2407"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2898..>2902)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2407"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2898..2902)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2407"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q29689"
FT                   /db_xref="IMGT/HLA:A*24:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29689"
FT                   /protein_id="ACR55719.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAQSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 2902 BP; 564 A; 831 C; 905 G; 602 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg caggtgagtg cggggtcggg agggaaacgg cctctgcggg gagaagcaag       120
     gggcccgcct ggcgggggcg caagacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggacgagga gacagggaaa gtgaaggccc agtcacagac       420
     tgaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc gggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg       900
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctacctgat      1020
     cgcctgtagg tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgacggaat gacggaaaga cgatccctcg aatactgatg actggttccc tttgacaccg      1260
     gcagcagcct tgggaccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttccctcct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcatg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc catcttccca gcccaccgtc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgctg      2040
     tgatgtggag gaggaacagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2100
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2160
     accatccaca atcatgggcc gacccagcct gggccctgtg tgccagcact tactcttttg      2220
     taaagcacct gtgacaatga aggacagatt tatcaccttg attatggcgg tgatgggacc      2280
     tgatcccagc agtcacaagt cacaggggaa ggtccctgac gacagatctc aggagggcga      2340
     ttggtccagg gcccacatct gctttcttca tgtttcctga tcctgccctg ggtctgcagt      2400
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2460
     gccctggctc ctttctggta tctcacagga cattttcttc ccacagatag aaaaggaggg      2520
     agctactctc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2580
     tgtgtttggg agcccatggg ggagctcaac caccccacaa ttcctcctct agccacatct      2640
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      2700
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg      2760
     gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttgcatt ggatgtattg      2820
     agcatgcgat gggctgttta aagtgtgacc cctcactgtg acagatatga agttgttcat      2880
     gaattttttt tctatagtgt ga                                               2902
//


spacer
spacer