Dbfetch

ID   FJ969862; SV 1; linear; genomic DNA; STD; HUM; 2902 BP.
XX
AC   FJ969862;
XX
DT   07-JUN-2009 (Rel. 101, Created)
DT   07-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0302 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2902
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   "Genomic sequence of HLA Class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2902
RA   Cheng L., Zou H., Zhu W., Du J., Li Z., Jin S., Wang D., Gao S., Cheng X.,
RA   Tian Z.;
RT   ;
RL   Submitted (28-APR-2009) to the INSDC.
RL   Immuongenetics Lab, ShenZhen Blood Center, MeiGang Nan Street, NiGang Xi
RL   Road, Futian District, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 1718ad8ce16f2d2480eedce2d6b654f6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2902
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2902
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT   mRNA            join(<1..73,204..473,715..990,1569..1844,1947..2063,
FT                   2506..2538,2681..2728,2898..>2902)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1569..1844,1947..2063,
FT                   2506..2538,2681..2728,2898..2902)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5IWY0"
FT                   /db_xref="IMGT/HLA:A*03:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IWY0"
FT                   /protein_id="ACR55717.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 2902 BP; 557 A; 828 C; 911 G; 606 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggacgagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccg ggggcgcagg tcaggacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggct gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg       900
     cggagcagca gagagcctac ctggatggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggagtg acgggaagac gatccctcga atactgatga gtggttccct ttgacaccgg      1260
     cagcagcctt gggcccgtga cttttcctct caggccttgt tctctgcttc acactcaatg      1320
     tgtgtggggg tctgagtcca gcacttctga gtccctcagc ctccactcag gtcaggacca      1380
     gaagtcgctg ttcccttctc agggaataga agattatccc aggtgcctgt gtccaggctg      1440
     gtgtctgggt tctgtgctct cttccccatc ccgggtgtcc tgtccattct caagatggcc      1500
     acatgcgtgc tggtggagtg tcccatgaca gatgcaaaat gcctgaattt tctgactctt      1560
     cccgtcagac ccccccaaga cacatatgac ccaccacccc atctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggggaggac cagacccagg acacggagct cgtggagacc aggcctgcag gggatggaac      1740
     cttccagaag tgggcggctg tggtggtgcc ttctggagag gagcagagat acacctgcca      1800
     tgtgcagcat gagggtctgc ccaagcccct caccctgaga tggggtaagg agggagatgg      1860
     gggtgtcatg tctcttaggg aaagcaggag cctctctgga gacctttagc agggtcaggg      1920
     cccctcacct tcccctcttt tcccagagct gtcttcccag cccaccatcc ccatcgtggg      1980
     catcattgct ggcctggttc tccttggagc tgtgatcact ggagctgtgg tcgctgccgt      2040
     gatgtggagg aggaagagct caggtggaga aggggtgaag ggtggggtct gagatttctt      2100
     gtctcactga gggttccaag ccccagctag aaatgtgccc tgtctcatta ctgggaagca      2160
     ccgtccacaa tcatgggcct acccagtctg ggccctgtgt gccagcactt actcttttgt      2220
     aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacggcggt gatgggacct      2280
     gatcccagca gtcacaagtc acaggggaag gtccctgagg acagacctca ggagggctat      2340
     tggtccagga cccacacctg ctttcttcat gtttcctgat cccgccctgg gtctgcagtc      2400
     acacatttct ggaaacttct ctggggtcca agactaggag gttcctctag gaccttaagg      2460
     ccctggctcc tttctggtat ctcacaggac attttcttct cacagataga aaaggaggga      2520
     gttacactca ggctgcaagt aagtatgaag gaggctgatg cctgaggtcc ttgggatatt      2580
     gtgtttggga gcccatgggg gagcccaccc acctcacaat tcctcctcta gccacatctt      2640
     ctgtgggatc tgaccaggtt ctgtttttgt tctaccccag gcagtgacag tgcccagggc      2700
     tctgatgtgt ccctcacagc ttgtaaaggt gagagcttgg aggacctaat gtgtgttggg      2760
     tgttgggcgg aacagtggac acagctgtgc tatggggttt ctttgcattg gatgtattga      2820
     gcatgcgatg ggctgtttaa ggtgtgaccc ctcactgtga tggatatgaa tttgttcatg      2880
     aatatttttt tctatagtgt ga                                               2902
//