spacer

EBI Dbfetch

ID   FJ966367; SV 1; linear; genomic DNA; STD; HUM; 1689 BP.
XX
AC   FJ966367;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*270502 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1689
RA   Alves H., Peixoto M., Tafulo S., Oliveira S., Balas A.;
RT   "Portuguese new HLA-B*27 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1689
RA   Alves H., Peixoto M., Tafulo S., Oliveira S., Balas A.;
RT   ;
RL   Submitted (23-APR-2009) to the INSDC.
RL   Direction, Centro de Histocompatibilidade do Norte, Rua Dr. Roberto Frias,
RL   Porto 4200-467, Portugal
XX
DR   MD5; 1dd606b83f5f9a2dfb590042de154176.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1689
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1689
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270502 variant"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..>1689)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270502 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..1689)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270502 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C5IUS6"
FT                   /db_xref="IMGT/HLA:B*27:52"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IUS6"
FT                   /protein_id="ACR83851.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   gap             1546..1645
FT                   /estimated_length=unknown
XX
SQ   Sequence 1689 BP; 215 A; 335 C; 367 G; 172 T; 600 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttccaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     caccgtgggc tacgtggacg acacgctgtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggacggag ccccgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tgcaaggcca aggcacagac tgaccgagag gacctgcgga ccctgctccg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aatatgtatg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggta ccaccaggac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagt ccaccgtccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctgctgtg atgtgtagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nngtggaaaa ggagggagct actctcaggc tgcgtnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnngcagc gacagtgccc agggctctga tgtgtctctc      1680
     acagcttga                                                              1689
//


spacer
spacer