Dbfetch

ID   FJ952590; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ952590;
XX
DT   31-MAY-2009 (Rel. 101, Created)
DT   31-MAY-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DR08) gene, HLA-DR08_459_00004
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (22-APR-2009) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; b3a8c73d0d9f79c2cf504a8c6343821a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DR08"
FT                   /allele="HLA-DR08_459_00004"
FT   mRNA            <1..>270
FT                   /gene="HLA-DR08"
FT                   /allele="HLA-DR08_459_00004"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DR08"
FT                   /allele="HLA-DR08_459_00004"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C4PJL7"
FT                   /db_xref="IMGT/HLA:DRB1*08:40"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C4PJL7"
FT                   /protein_id="ACR38918.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DR08"
FT                   /allele="HLA-DR08_459_00004"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//