spacer

EBI Dbfetch

ID   FJ938169; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ938169;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   03-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQ) gene, HLA-DQB*0401 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Zhang Z., Xhan X., Li W., Wang L., Wang L., Liu N., Cui S., Gong Z.,
RA   Zhao B., Ni L., Wang O.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Zhang Z., Xhan X., Li W., Wang L., Wang L., Liu N., Cui S., Gong Z.,
RA   Zhao B., Ni L., Wang O.;
RT   ;
RL   Submitted (16-APR-2009) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing, Beijing 100088, China
XX
DR   MD5; 28c9e28b06a07d2bab4bf557ca69337b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQ"
FT                   /allele="HLA-DQB*0401 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQ"
FT                   /allele="HLA-DQB*0401 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQ"
FT                   /allele="HLA-DQB*0401 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C5IHT1"
FT                   /db_xref="IMGT/HLA:DQB1*04:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C5IHT1"
FT                   /protein_id="ACR10431.1"
FT                   /translation="DFVFQFKGMCYFTNGTELVRGVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQ"
FT                   /allele="HLA-DQB*0401 new"
FT                   /number=2
FT   variation       212
FT                   /gene="HLA-DQ"
FT                   /replace="g"
XX
SQ   Sequence 270 BP; 58 A; 69 C; 94 G; 49 T; 0 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacc gagctcgtgc        60
     ggggtgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc ggcttgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg ttgacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer