spacer

EBI Dbfetch

ID   FJ912900; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ912900;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1-060101 new
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yun J., Yan L., Ying S.;
RT   "Identified a novel allele by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Yun J., Yan L., Ying S.;
RT   ;
RL   Submitted (25-MAR-2009) to the INSDC.
RL   Shanghai Blood Center, No. 1191 Hongqiao Road, Shanghai, Shanghai 200051,
RL   China
XX
DR   MD5; 62db8d099099c60e4f768b0ae9d433c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6P21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1-060101 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1-060101 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1-060101 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D5G2J7"
FT                   /db_xref="IMGT/HLA:DQB1*06:35"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D5G2J7"
FT                   /protein_id="ACZ05033.1"
FT                   /translation="DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVEVYRAV
FT                   TPLGRPDAEYWNSQKDILERTRAELDTVCRHNYEVAFRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1-060101 new"
FT                   /number=2
FT   variation       121
FT                   /gene="HLA-DQB1"
FT                   /replace="g"
FT                   /note="results in glutamic acid to glycine substitution"
FT   variation       128
FT                   /gene="HLA-DQB1"
FT                   /replace="t"
FT   variation       141
FT                   /gene="HLA-DQB1"
FT                   /replace="a"
FT                   /note="results in proline to threonine substitution"
XX
SQ   Sequence 270 BP; 61 A; 65 C; 97 G; 47 T; 0 other;
     aggatttcgt gctccagttt aaggccatgt gctacttcac caatgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//


spacer
spacer