Dbfetch

ID   FJ898284; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FJ898284;
XX
DT   11-MAY-2009 (Rel. 100, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5501 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2009.01422.x.
RX   PUBMED; 20196828.
RA   Zhuang Y.-L., Song Y.-H., Zhang Y., Nie X.-M., Zhu C.-F.;
RT   "A novel HLA-B allele, B*5535, was identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 75(2):178-179(2010).
XX
RN   [2]
RP   1-646
RA   Zhu C., Fang Y., Nie X., He W., Zhang Y., Liu Y.;
RT   "Identification of a novel HLA-B*55 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Zhu C., Fang Y., Nie X., He W., Zhang Y., Liu Y.;
RT   ;
RL   Submitted (07-APR-2009) to the INSDC.
RL   HLA Lab, Blood Center of Shandong Province, No. 22 East Shanshi Road,
RL   Jinan, ShanDong 250014, P.R. China
XX
DR   MD5; 8e520ff6887eb707f2077350a752c0cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501 variant"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen B"
FT                   /db_xref="GOA:C4P7I3"
FT                   /db_xref="IMGT/HLA:B*55:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C4P7I3"
FT                   /protein_id="ACQ73744.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5501 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 171 C; 192 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//