Dbfetch

ID   FJ877151; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ877151;
XX
DT   28-APR-2009 (Rel. 100, Created)
DT   28-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Faner R., Caro P., Mongay L., Campos E., Gil J., Ambros C., Mantecon S.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   "Identification of a new DRB1*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Faner R., Caro P., Mongay L., Campos E., Gil J., Ambros C., Mantecon S.,
RA   Pujol-Borrell R., Herrero M.J., Palou E.;
RT   ;
RL   Submitted (02-APR-2009) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Crta de Canyet sn, Badalona, Barcelona
RL   08916, Spain
XX
DR   MD5; c59045ec1a27f1b9d60faa97790b906b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C3VN82"
FT                   /db_xref="IMGT/HLA:DRB1*03:42"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C3VN82"
FT                   /protein_id="ACP31208.1"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 100 G; 48 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//