Dbfetch

ID   FJ870104; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ870104;
XX
DT   22-APR-2009 (Rel. 100, Created)
DT   25-SEP-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01329.x.
RX   PUBMED; 19775375.
RA   Li Z., Zhang L.-H., Zou H.-Y., Jin S.-Z.;
RT   "A novel HLA-DRB1 allele, DRB1*112802, was identified in a Chinese
RT   individual";
RL   Tissue Antigens 74(4):350-352(2009).
XX
RN   [2]
RP   1-270
RA   Li Z., Zou H.-Y., Cheng L.-H.;
RT   ;
RL   Submitted (28-MAR-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; e0a7a6b5882ab1fb6371653d5bd0bc29.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C3VJ06"
FT                   /db_xref="IMGT/HLA:DRB1*11:28:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C3VJ06"
FT                   /protein_id="ACO92388.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /number=2
FT   variation       81
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /compare=AY277387.1
FT                   /note="results in histidine to tyrosine substitution
FT                   compared to HLA-DRB1*1109"
XX
SQ   Sequence 270 BP; 58 A; 62 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//