spacer

EBI Dbfetch

ID   FJ868794; SV 1; linear; genomic DNA; STD; HUM; 1801 BP.
XX
AC   FJ868794;
XX
DT   22-APR-2009 (Rel. 100, Created)
DT   10-DEC-2009 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*08 new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1801
RX   DOI; 10.1111/j.1399-0039.2009.01371.x.
RX   PUBMED; 19761532.
RA   Balas A., Bustamante L., Garcia-Sachez F., Vicario J.L.;
RT   "New HLA polymorphism detection by molecular and serologic typing
RT   procedures. Complete coding region characterization of Cw*0525, Cw*0825,
RT   B*3950 and A*3219N alleles";
RL   Tissue Antigens 74(6):553-554(2009).
XX
RN   [2]
RP   1-1801
RA   Balas A., Garcia-Sachez F., Vicario J.L.;
RT   ;
RL   Submitted (27-MAR-2009) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; 4c6d9e57579136ef45a1ee37fc0e562b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1801
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08 new"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1415,
FT                   1516..1548,1649..1696,1797..>1801)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1415,
FT                   1516..1548,1649..1696,1797..1801)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08 new"
FT                   /product="MHC class I antigen"
FT                   /note="human histocompatibility antigen C"
FT                   /db_xref="GOA:C3VIR6"
FT                   /db_xref="IMGT/HLA:C*08:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C3VIR6"
FT                   /protein_id="ACO88011.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1416..1515
FT                   /estimated_length=unknown
FT   gap             1549..1648
FT                   /estimated_length=unknown
FT   gap             1697..1796
FT                   /estimated_length=unknown
XX
SQ   Sequence 1801 BP; 218 A; 337 C; 373 G; 173 T; 700 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacaggc tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg aatgaggacc       660
     tgcgctcctg gaccgccgcg gacaaggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagcgg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag aagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg ccagagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggcca tcttcccagc ccaccatccc      1320
     catcgtgggc atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt      1380
     gatggctgtt gtgatgtgta ggaggaagag ctcagnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnngtgga aaaggaggga gctgctctca ggctgcgtnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnncc agcaacagtg cccagggctc tgatgagtct      1680
     ctcatcgctt gtaaagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncctg      1800
     a                                                                      1801
//


spacer
spacer