spacer

EBI Dbfetch

ID   FJ868754; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   FJ868754;
XX
DT   28-APR-2009 (Rel. 100, Created)
DT   28-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1301var allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Vigh A., Fuerst D., Mytilineos J.;
RT   "Characterization of a new HLA-B*1301 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Vigh A., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (27-MAR-2009) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics Ulm, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; 9ca7adff7dafaf615953f877cbe54cf4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301var"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C3VIR4"
FT                   /db_xref="IMGT/HLA:B*13:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C3VIR4"
FT                   /protein_id="ACP31209.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301var"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301var"
FT                   /number=3
XX
SQ   Sequence 791 BP; 145 A; 265 C; 275 G; 106 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggccggg gccagggtct cacatcatcc agaggatgta       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt tagcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcag cggacaccgc       660
     ggctcagatc acccagctca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer