spacer

EBI Dbfetch

ID   FJ853804; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   FJ853804;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   25-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens clone B_402_01269 MHC class I antigen (HLA-B) gene, HLA-B*402
DE   new allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (24-MAR-2009) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; 351805f344b85fcc31b189314dc848c5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="B_402_01269"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*402 new"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*402 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*402 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D4HPC3"
FT                   /db_xref="IMGT/HLA:B*15:177"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D4HPC3"
FT                   /protein_id="ACO91557.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFGRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETRNMKASAQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*402 new"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*402 new"
FT                   /number=3
XX
SQ   Sequence 788 BP; 107 A; 174 C; 196 G; 69 T; 242 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgg gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac accctccaga ggatgtacgg       540
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggtac caccaggacg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acacggcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg gagcagctga gagcctacct       720
     ggagggcctg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcgcgg                                                                788
//


spacer
spacer