Dbfetch

ID   FJ827122; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ827122;
XX
DT   09-JUN-2009 (Rel. 101, Created)
DT   09-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*150101 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Parkner A.M., Mosebach M., Halm-Heinrich I., Heim M.U.;
RT   "Identification of a novel HLA-DRB1*15 allele in a recently registered stem
RT   cell donor";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Parkner A.M., Mosebach M., Halm-Heinrich I., Heim M.U.;
RT   ;
RL   Submitted (16-MAR-2009) to the INSDC.
RL   HLA Laboratory, Institute of Transfusion Medicine, Leipziger Str. 44,
RL   Magdeburg 39120, Germany
XX
DR   MD5; c7a8e2422cc80dd5f5e7dd78afeacab9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: DR_2fa1, rev_name: DR_2ra;
FT                   PCR_primers=fwd_name: DR_2fa2"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C5IAX3"
FT                   /db_xref="IMGT/HLA:DRB1*15:33"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C5IAX3"
FT                   /protein_id="ACR61333.1"
FT                   /translation="RFLWQPKRESHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101 variant"
FT                   /number=2
FT   variation       30
FT                   /gene="HLA-DRB1"
FT                   /replace="t"
FT                   /note="results in serine to cysteine substitution"
XX
SQ   Sequence 270 BP; 56 A; 66 C; 101 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggaga gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//