Dbfetch

ID   FJ825144; SV 1; linear; genomic DNA; STD; HUM; 2895 BP.
XX
AC   FJ825144;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*08new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2895
RX   DOI; 10.1111/j.1399-0039.2009.01343.x.
RX   PUBMED; 19843278.
RA   Wang D.-M., Zou H.-Y., Li Z.;
RT   "Identification of a novel HLA-Cw*08 variant allele, Cw*0824";
RL   Tissue Antigens 75(1):86-87(2010).
XX
RN   [2]
RP   1-2895
RA   Wang D.-M., Li Z., Zou H.-Y.;
RT   ;
RL   Submitted (13-MAR-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 9cc0d743f4c6cea3a61dd94cf81e8782.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2895
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT   mRNA            join(<1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..>2895)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..2895)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C1KGA3"
FT                   /db_xref="IMGT/HLA:C*08:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C1KGA3"
FT                   /protein_id="ACO40493.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGKDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=2
FT   exon            720..995
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=3
FT   exon            1583..1858
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=4
FT   variation       1699
FT                   /gene="HLA-Cw"
FT                   /replace="g"
FT                   /note="results in Lys to Glu substitution"
FT   exon            1980..2099
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=5
FT   exon            2539..2571
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=6
FT   exon            2679..2726
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=7
FT   exon            2891..>2895
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08new"
FT                   /number=8
XX
SQ   Sequence 2895 BP; 546 A; 838 C; 921 G; 590 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgtgagtg cgaggttggg agggaaacgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcagttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcccgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggctggggcg gggctcgggg gacggggctg accacggggg cggggccagg       720
     gtctcacacc ctccagagga tgtatggctg cgacctgggg cccgacgggc gcctcctccg       780
     cgggtataac cagttcgcct acgacggcaa ggattacatc gccctgaatg aggacctgcg       840
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tacggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaagaaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cccatctcct gtagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca      1080
     gcgctggaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      1320
     ttaaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggat ggtcacatgg gcactgttgg agtgtcgcaa gagagataca aagtgtctga      1560
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagc gggatggcaa ggaccaaact caggacaccg agcttgtgga gaccaggcca      1740
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      1800
     agatacacgt gccatgtgca gcacgagggg ctgccagagc ccctcaccct gagatggggt      1860
     aaggaggggg atgaggggtc atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      1920
     agccgggtca gggctgaggc ttgggggtca gggcccctca ccttcccctc ctttcccagg      1980
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2040
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      2100
     tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc cactgggagt ttcaagcccc      2160
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2220
     ctgggaccct gtgtgctagc acttactctg ttgtgaagca catgacaatg aaggacagat      2280
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2340
     aggtccctgc taaggacaga ccttaggagg gcagttgctc cagaacccac agctgctttc      2400
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2460
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2520
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2580
     ggcggtgggc gtgtggagga gctcacccac cccataattc ctcttgtccc acatctcctg      2640
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      2700
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      2760
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      2820
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      2880
     tgttctgtag cctga                                                       2895
//