spacer

EBI Dbfetch

ID   FJ811898; SV 1; linear; genomic DNA; STD; HUM; 2903 BP.
XX
AC   FJ811898;
XX
DT   05-APR-2009 (Rel. 100, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*07new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2903
RX   DOI; 10.1111/j.1399-0039.2009.01349.x.
RX   PUBMED; 19737368.
RA   Zou H.Y., Jin S.Z., Li Z., Cheng L.H.;
RT   "Full-length sequence of a novel allele, HLA-Cw*070205";
RL   Tissue Antigens 74(5):455-456(2009).
XX
RN   [2]
RP   1-2903
RA   Zou H.-Y., Cheng L.-H., Li Z.;
RT   "A new HLA-Cw*07 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-2903
RA   Zou H.-Y., Cheng L.-H., Li Z.;
RT   ;
RL   Submitted (08-MAR-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; c7cbc76d1fb0114a55ee635afdb0cd15.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2903
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2903
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT   mRNA            join(<1..73,204..473,724..999,1587..1862,1987..2106,
FT                   2547..2579,2687..2734,2899..>2903)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,724..999,1587..1862,1987..2106,
FT                   2547..2579,2687..2734,2899..2903)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6R739"
FT                   /db_xref="IMGT/HLA:C*07:02:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R739"
FT                   /protein_id="ACO37269.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   exon            724..999
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
FT   exon            1587..1862
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=4
FT   exon            1987..2106
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=5
FT   exon            2547..2579
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=6
FT   exon            2687..2734
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=7
FT   exon            2899..>2903
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=8
XX
SQ   Sequence 2903 BP; 540 A; 845 C; 925 G; 593 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaagcgg cctctgcgga gaggagcgag       120
     gggccctccc ggcgagggcg caggacccgg ggagccgcgc agggaggtgg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttcgaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     ccagagtctc cccgtctgag atccacccca aggtggatct gcggaacccg cccagaccct       600
     cgaccggaga gagccccagt cgcctttacc cggtttcatt ttcggtttag gccaaaatcc       660
     ccgcgggttg gtcggggcgg ggcggggctc gggggactgg gctgaccgcg ggggcggggc       720
     cagggtctca caccctccag aggatgtctg gctgcgacct ggggcccgac gggcgcctcc       780
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       840
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagattac ccagcgcaag ttggaggcgg       900
     cccgtgcggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       960
     gatacctgga gaacgggaag gagacgctgc agcgcgcagg taccaggggc agtggggagc      1020
     cttccccatc tcctatagat ctcccgggat ggcctcccac gaggagggga ggaaaatggg      1080
     atcagcactg gaatatcgcc ctcccttgaa tggagaatgg catgagtttt cctgagtttc      1140
     ctctgagggc cccctctgct ctctaggaca attaagggat gaagtctctg aggaaatgga      1200
     ggggaagaca gtccctggaa tactgatcag gggtctcctt tgaccacttt gaccactgca      1260
     gcagctgtgg tcaggctgct gacctttctc tcaggccttg ttctctgcct cacactcaat      1320
     gtgtctgaag gtttgattcc agcttttctg agtcctgcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcctccct cagagactag aactttccaa tgaataggag attatcccag      1440
     gtgcctgtgt ccaggctggc gtctgggttc tgtgccgcct tccccacccc aggtgtcctg      1500
     tccattctca ggatggtcac atgggcgctg ctggagtgtc ccaagagaga tgcaaagtgt      1560
     ctgaattttc tgactcttcc cgtcagaacc cccaaagaca cacgtgaccc accaccccct      1620
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1680
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag      1740
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga      1800
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1860
     gggtaaggag gggaatgggg ggtcacatct cttatcagag aaagcagaag tccttctgga      1920
     gcccttcagc cgggtcaggg ctgaggcttg ggggtcaggg cccctcacct tctcctcctt      1980
     tcccagagcc atcttcccag cccaccatcc ccatcatggg catcgttgct ggcctggctg      2040
     tcctggttgt cctagctgtc cttggagctg tggtcaccgc tatgatgtgt aggaggaaga      2100
     gctcaggtag ggaaggggtg aagagcgggg tctgggtttt cttgtcccac tgggagtttc      2160
     aagccccagg tagaagtgtg ccccgccttg ttactggaag caccatccac acatgggcca      2220
     tcccagcctg ggaccctgtg tgccagcact tactcttttg tgaagcacat gtgacaatga      2280
     aggacggatg tatcaccttg atgattatgg tgttggggtc ctgattccag cattcatgag      2340
     tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca gaacccacaa      2400
     ctgctttccc catgtttcct gatcctgccc tgggtctgca gtcgtagttc tggaaacttc      2460
     tcttgggtcc aagactagga ggttccccta agatcacatg gccctgcctc ctcccagtcc      2520
     cctcataggg cattttcttc ccacaggtgg aaaaggaggg agctgctctc aggctgcgtg      2580
     taagtgatgg cggcgggcgt gtggaggagc tcacctactc cataattcct cttgtcccac      2640
     atctcctgcg ggctctgacc aggtcttttt ttttgttcta ccccaggcag caacagtgcc      2700
     cagggctctg atgagtctct catcacttgt aaaggtgaga ttctggggag ctgaagtggt      2760
     cgggggtggg gcagagggaa aaggcctggg taatggggat tctttgattg ggacgtttcg      2820
     agtgtgtggt gggccgttca gagtgtcatc gcttaccatg actgacctga atttgttcat      2880
     gactattgtg ttctgtagcc tga                                              2903
//


spacer
spacer