spacer

EBI Dbfetch

ID   FJ810063; SV 1; linear; genomic DNA; STD; HUM; 580 BP.
XX
AC   FJ810063;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-580
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 2e7cc954ba47164e5fd20bdc8f8609e3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..580
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>580
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant"
FT   mRNA            <267..>536
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <267..>536
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C1KBK0"
FT                   /db_xref="IMGT/HLA:DRB1*11:73"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBK0"
FT                   /protein_id="ACO40332.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDILEDKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            267..536
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant"
FT                   /number=2
XX
SQ   Sequence 580 BP; 103 A; 153 C; 219 G; 105 T; 0 other;
     aggtctccag aacaggctgg aggtagggag gggggtccca aaagcctggg gatcagacgt        60
     ggttttcccg cctggtcccc caggccccct ttcgcctcag gaagacagag gaggagcccc       120
     tgggctgcag gtggtgggcg ttgcggcggg ggccggttaa ggttcccagt gcccgcaccc       180
     ggcccaggga gccccggatg gcggcgtcac tgtcagtgtc ttctcaggag gccgcctgtg       240
     tgactggatc gttcgtgtcc ccacagcacg tttcttggag tactctacgt ctgagtgtca       300
     tttcttcaat gggacggagc gggtgcggtt cctggacaga tacttctata accaagagga       360
     gtacgtgcgc ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc       420
     tgatgaggag tactggaaca gccagaagga catcctggaa gacaagcggg ccgcggtgga       480
     cacctactgc agacacaact acggggttgg tgagagcttc acggtgcagc ggcgaggtga       540
     gcgcggcgcg gggcggggcc tgagtccctg tgagctggga                             580
//


spacer
spacer