Dbfetch

ID   FJ810062; SV 1; linear; genomic DNA; STD; HUM; 1168 BP.
XX
AC   FJ810062;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*07 variant allele,
DE   exons 1 through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1168
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 6c5c76ec469442676fb2efa980d296a2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1168
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <59..>1057
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT   mRNA            join(<59..131,262..531,782..>1057)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(59..131,262..531,782..>1057)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*07:67"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ9"
FT                   /protein_id="ACO40331.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLVGTCVEWLRRYLENGKETLQRA"
FT   exon            59..131
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT                   /number=1
FT   exon            262..531
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT                   /number=2
FT   exon            782..1057
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07 variant"
FT                   /number=3
XX
SQ   Sequence 1168 BP; 199 A; 390 C; 417 G; 162 T; 0 other;
     tcccggttct aaagtcccca gtcacccacc cggactcaca ttctccccag aggccgagat        60
     gcgggtcatg gcgccccgag ccctcctcct gctgctctcg ggaggcctgg ccctgaccga       120
     gacctgggcc tgtgagtgcg gggttgggag ggaagcggcc tctgcggaga ggagcgaggg       180
     gccctcccgg cgagggcgca ggacccgggg agccgcgcag ggaggtgggt cgggcgggtc       240
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttcgacacc gccgtgtccc       300
     ggcccggccg cggagagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       360
     tgcggttcga cagcgacgcc gcgagtccga gaggggagcc gcgggcgccg tgggtggagc       420
     aggaggggcc ggagtattgg gaccgggaga cacagaagta caagcgccag gcacaggctg       480
     accgagtgag cctgcggaac ctgcgcggct actacaacca gagcgaggac ggtgagtgac       540
     cccggcccgg ggcgcaggtc acgacccctc cccatccccc acggacggcc cgggtcgccc       600
     agagtctccc cgtctgagat ccaccccaag gtggatctgc ggaacccgcc cagaccctcg       660
     accggagaga gccccagtcg cctttacccg gtttcatttt cggtttaggc caaaatcccc       720
     gcgggttggt cggggcgggg cggggctcgg gggactgggc tgaccgcggg ggcggggcca       780
     gggtctcaca ccctccagag gatgtctggc tgcgacctgg ggcccgacgg gcgcctcctc       840
     cgcgggtatg accagtccgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg       900
     cgctcctgga ccgccgcgga caccgcggct cagatcaccc agcgcaagtt ggaggcggcc       960
     cgtgcggcgg agcagctgag agcctacctg gtgggcacgt gcgtggagtg gctccgcaga      1020
     tacctggaga acgggaagga gacgctgcag cgcgcaggta ccaggggcag tggggagcct      1080
     tccccatctc ctatagatct cccgggatgg cctcccacga ggaggggagg aaaatgggat      1140
     cagcactgga aaatcgccct cccttgaa                                         1168
//