Dbfetch

ID   FJ810061; SV 1; linear; genomic DNA; STD; HUM; 1803 BP.
XX
AC   FJ810061;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   07-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*46 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1803
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 8941781c3b0febd6ef4db932dafc27ec.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1803
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1803
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT   mRNA            join(<113..382,628..903,1479..>1754)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<113..382,628..903,1479..>1754)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*46:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ8"
FT                   /protein_id="ACO40330.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            113..382
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /number=2
FT   exon            628..903
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /number=3
FT   exon            1479..1754
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /number=4
XX
SQ   Sequence 1803 BP; 349 A; 549 C; 597 G; 308 T; 0 other;
     agggaaatgg cctctgtggg gaggagcgag gggaccgcag gcgggggcgc aggacccggg        60
     gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct cctcgccccc aggctcccac       120
     tccatgaggt atttctacac cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc       180
     gcagtgggct acgtggacga cacccagttc gtgaggttcg acagcgacgc cgcgagtccg       240
     aggatggcgc cccgggcgcc atggatagag caggaggggc cggagtattg ggaccgggag       300
     acacagaagt acaagcgcca ggcacagact gaccgagtga gcctgcggaa cctgcgcggc       360
     tactacaacc agagcgaggc cggtgagtga ccccggcctg gggcgcaggt cacgactccc       420
     catcccccac gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcccccctga       480
     ggccgcggga cccgcccaaa ccctcgaccg gcgagagccc caggcgcgtt tacccggttt       540
     cattttcagt tgaggccaaa atccccgcgg gttggtcggg gcggggcggg gctcggggga       600
     cggggctgac cgcggggcct gggccagggt ctcacaccct ccagaggatg tacggctgcg       660
     acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca gtccgcctac gacggcaagg       720
     attacatcgc cctgaacgag gacctgagct cctggaccgc ggcggacacg gcggctcaga       780
     tcacccagcg caagtgggag gcggcccgtg tggcggagca gctgagaacc tacctggagg       840
     gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg       900
     cgggtaccag gggcagtggg gagccttccc catctcctat aggtcgccgg ggatggcctc       960
     ccacgagaag aggaggaaaa tgggatcagc gctagaatgt cgccctccct tgaatggaga      1020
     atggcatgag ttttcctgag tttcctctga gggccccctc ttctctctag gacaattaag      1080
     ggatgacgtc tctgaggaaa tggaggggaa gacagtccct aggatagtga tcaggggtcc      1140
     cctttgaccc ctgcagcagc cttgggaacc gtgacttttc ctctcaggcc ttgttctctg      1200
     cctcacactc agtgtgtttg gggctctgat tccagcactt ctgagtcact ttacctccac      1260
     tcagatcagg agcagaagtc cctgttcccc gctcagagac tcgaactttc caatgaatag      1320
     gagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc cttccccacc      1380
     ccaggtgtcc tgtccattct caggctggtc acatgggtgg tcctagggtg tcccatgaga      1440
     gatgcaaagc gcctgaattt tctgactctt cccatcagac cccccaaaga cacatgtgac      1500
     ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg gcttctaccc      1560
     tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg acaccgagct      1620
     tgtggagacc agaccagcag gagatagaac cttccagaag tgggcagctg tggtggtgcc      1680
     ttctggagaa gagcagagat acacatgcca tgtacagcat gaggggctgc cgaagcccct      1740
     caccctgaga tggggtaagg agggggatga ggggtcatat ctgttctcag ggaaagcagg      1800
     aga                                                                    1803
//