Dbfetch

ID   FJ810060; SV 1; linear; genomic DNA; STD; HUM; 1219 BP.
XX
AC   FJ810060;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   07-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0203 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1219
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 420a0dfb92d14dbcdb8e9b2e725f042c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1219
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1219
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203 variant"
FT   mRNA            join(<89..358,600..>875)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<89..358,600..>875)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C1KBJ7"
FT                   /db_xref="IMGT/HLA:A*02:171:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ7"
FT                   /protein_id="ACO40329.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            89..358
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203 variant"
FT                   /number=2
FT   exon            600..875
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203 variant"
FT                   /number=3
XX
SQ   Sequence 1219 BP; 231 A; 381 C; 411 G; 196 T; 0 other;
     gcaacgggcc cgcctggcgg gggcgcagga cccgggaagc cgcgccggga ggagggtcgg        60
     gcgggtctca gccactcctc gtccccaggc tctcactcca tgaggtattt cttcacatcc       120
     gtgtcccggc ccggccgcgg ggagccccgc ttcatcgcag tgggctacgt ggacgacacg       180
     cagttcgtgc ggttcgacag cgacgccgcg agccagagga tggagccgcg ggcgccgtgg       240
     atagagcagg agggtccgga gtattgggac ggggagacac ggaaagtgaa ggcccactca       300
     cagactcacc gagtggacct ggggaccctg cgcggctact acaaccagag cgaggccggt       360
     gagtgacccc ggcccggggc gcaggtcacg acctctcatc ccccacggac gggccaggtc       420
     gcccacagtc tccgggtccg agatccgccc cgaagccgcg ggaccccgag acccttgccc       480
     cgggagaggc ccaggcgcct ttacccggtt tcattttcag tttaggccaa aaatcccccc       540
     aggttggtcg gggcggggcg gggctcgggg gaccgggctg accgcggggt ccgggccagg       600
     ttctcacacc gtccagagga tgtatggctg cgacgtgggg tcggactggc gcttcctccg       660
     cgggtaccac cagtacgcct acgacggcaa ggattacatc gccctgaaag aggacctgcg       720
     ctcttggacc gcggcggaca tggcagctca gaccaccaag cacaagtggg agacggccca       780
     tgaggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       840
     cctggagaac gggaaggaga cgctgcagcg cacgggtacc aggggccacg gggcgcctcc       900
     ctgatcgcct gtagatctcc cgggctggcc tcccacaagg aggggagaca attgggacca       960
     acactagaat atcgccctcc ctctggtcct gagggagagg aatcctcctg ggtttccaga      1020
     tcctgtacca gagagtgact ctgaggttcc gccctgctct ctgacacaat taagggataa      1080
     aatctctgaa ggaatgacgg gaagacgatc cctcgaatac tgatgagtgg ttccctttga      1140
     cacacacagg cagcagcctt gggcccgtga cttttcctct caggccttgt tctctgcttc      1200
     acactcaatg tgtgtgggg                                                   1219
//