Dbfetch

ID   FJ810059; SV 1; linear; genomic DNA; STD; HUM; 1800 BP.
XX
AC   FJ810059;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1800
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; be12f27123045804456a4a0ded97ccbe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1800
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT   mRNA            join(<70..339,581..856,1436..>1711)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<70..339,581..856,1436..>1711)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:112"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ6"
FT                   /protein_id="ACO40328.1"
FT                   /translation="SHSMKYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAQSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            70..339
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=2
FT   exon            581..856
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=3
FT   exon            1436..1711
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=4
XX
SQ   Sequence 1800 BP; 352 A; 548 C; 582 G; 318 T; 0 other;
     ggggcgcaag acccgggaag ccgcgccggg aggagggtcg ggcgggtctc agccactcct        60
     cgtccccagg ctcccactcc atgaagtatt tctccacatc cgtgtcccgg cccggccgcg       120
     gggagccccg cttcatcgcc gtgggctacg tggacgacac gcagttcgtg cggttcgaca       180
     gcgacgccgc gagccagagg atggagccgc gggcgccgtg gatagagcag gaggggccgg       240
     agtattggga cgaggagaca gggaaagtga aggcccagtc acagactgac cgagagaacc       300
     tgcggatcgc gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       360
     cgcaggtcac gacccctcat cccccacgga cgggccgggt cgcccacagt ctccgggtcc       420
     gagatccacc ccgaagccgc gggaccccga gacccttgcc ccgggagagg cccaggcgcc       480
     ttaacccggt ttcattttca gtttaggcca aaaatccccc cgggttggtc ggggccgggc       540
     ggggctcggg ggactgggct gaccgcgggg tcggggccag gttctcacac cctccagatg       600
     atgtttggct gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca ccagtacgcc       660
     tacgacggca aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac       720
     atggcggctc agatcaccaa gcgcaagtgg gaggcggccc atgtggcgga gcagcagaga       780
     gcctacctgg agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag       840
     acgctgcagc gcacgggtac caggggccac ggggcgccta cctgatcgcc tgtaggtctc       900
     ccgggctggc ctcccacaag gaggggagac aattgggacc aacactagaa tatcgccctc       960
     cctctggtcc tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgac      1020
     tctgaggttc cgccctgctc tctgacacaa ttaagggata aaatctctga cggaatgacg      1080
     gaaagacgat ccctcgaata ctgatgactg gttccctttg acaccggcag cagccttggg      1140
     accgtgactt ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct      1200
     gagtccagca cttctgagtc cctcagcctc cactcaggtc aggaccagaa gtcgctgttc      1260
     cctcctcagg gaatagaaga ttatcccagg tgcctgtgtc caggctggtg tctgggttct      1320
     gtgctctctt ccccatcccg ggtgtcctgt ccattctcaa gatggccaca tgcatgctgg      1380
     tggagtgtcc catgacagat gcaaaatgcc tgaattttct gactcttccc gtcagacccc      1440
     cccaagacac atatgaccca ccaccccatc tctgaccatg aggccactct gagatgctgg      1500
     gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag      1560
     acccaggaca cggagcttgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg      1620
     gcagctgtgg tggtaccttc tggagaggag cagagataca cctgccatgt gcagcatgag      1680
     ggtctgccca agcccctcac cctgagatgg ggtaaggagg gagatggggg tgtcatgtct      1740
     cttagggaaa gcaggagcct ctctggagac ctttagcagg gtcagggccc cagagaggct      1800
//