Dbfetch

ID   FJ810058; SV 1; linear; genomic DNA; STD; HUM; 1207 BP.
XX
AC   FJ810058;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*26 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1207
RA   Qiu Q., He J., Yan X., Bao X., Cen J., Yao L., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 33c0ab102ef85b14a10e9005e3acd215.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1207
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1207
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 variant"
FT   mRNA            join(<48..317,559..>834)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<48..317,559..>834)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*26:01:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ5"
FT                   /protein_id="ACO40327.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            48..317
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 variant"
FT                   /number=2
FT   exon            559..834
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 variant"
FT                   /number=3
XX
SQ   Sequence 1207 BP; 225 A; 381 C; 401 G; 200 T; 0 other;
     gcgcctggag gagggtcggg cgggtctcag ccactcctcg cccccaggct cccactccat        60
     gaggtatttc tacacctccg tgtcccggcc cggccgcggg gagccccgct tcatcgccgt       120
     gggctacgtg gacgacacgc agttcgtgcg gttcgacagc gacgccgcga gccagaggat       180
     ggagccgcgg gcgccgtgga tagagcagga ggggccggag tattgggacc ggaacacacg       240
     gaatgtgaag gcccactcac agactgaccg agcgaacctg gggaccctgc gcggctacta       300
     caaccagagt gaggacggtg agtgaccccg gcccggggcg caggtcacga cccctcatcc       360
     cccacggacg ggccaggtcg cccacagtct ccgggtccga gatccgcccc gaagccgcgg       420
     gaccccgaga cccttgcccc gggagaggcc caggcgcctt tacccggttt cattttcagt       480
     ttaggccaaa aatccccccg ggttggtcgg ggcggggcgg ggctcggggg accgggctga       540
     cctcggggtc cgggccaggt tctcacacca tccagaggat gtatggctgc gacgtggggc       600
     cggacgggcg cttcctccgc gggtaccagc aggacgctta cgacggcaag gattacatcg       660
     ccctgaacga ggacctgcgc tcttggaccg cggcggacat ggcggctcag atcacccagc       720
     gcaagtggga gacggcccat gaggcggagc agtggagagc ctacctggag ggccggtgcg       780
     tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc acgggtacca       840
     ggggccacgg ggcgcctccc tgatcgcctg tagatctccc gggctggcct cccacaagga       900
     ggggagacaa ttgggaccaa cactagaata tcgccctccc tctggtcctg agggagagga       960
     atcctcctgg gtttccagat cctgtaccag agagtgactc tgaggttccg ccctgctctc      1020
     tgacacaatt aagggataaa atctctgaag gaatgacggg aagacgatcc ctcgaatact      1080
     gatgagtggt tccctttgac acacaccggc agcagccttg ggcccgtgac ttttcctctc      1140
     aggccttgtt ctctgcttca cactcaatgt gtgtgggggt ctgagtccag cacttctgag      1200
     tccctca                                                                1207
//