spacer

EBI Dbfetch

ID   FJ810057; SV 1; linear; genomic DNA; STD; HUM; 1166 BP.
XX
AC   FJ810057;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0206 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1166
RA   Qiu Q., He J., Yan X., Bao X., Yao L., Cen J., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 363a6116ad6938847fda1dcfcc08adf5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1166
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1166
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206 variant"
FT   mRNA            join(<97..366,608..>883)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<97..366,608..>883)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C1KBJ4"
FT                   /db_xref="IMGT/HLA:A*02:170"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ4"
FT                   /protein_id="ACO40326.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQCT"
FT   exon            97..366
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206 variant"
FT                   /number=2
FT   exon            608..883
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206 variant"
FT                   /number=3
XX
SQ   Sequence 1166 BP; 226 A; 363 C; 401 G; 176 T; 0 other;
     ggggagaagc aacgggcccg cctggcgggg gcgcaggacc cgggaagccg cgccgggagg        60
     agggtcgggc gggtctcagc cactcctcgt ccccaggctc tcactccatg aggtatttct       120
     acacctccgt gtcccggccc ggccgcgggg agccccgctt catcgcagtg ggctacgtgg       180
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaggatg gagccgcggg       240
     cgccgtggat agagcaggag ggtccggagt attgggacgg ggagacacgg aaagtgaagg       300
     cccactcaca gactcaccga gtggacctgg ggaccctgcg cggctactac aaccagagcg       360
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac ctctcatccc ccacggacgg       420
     gccaggtcgc ccacagtctc cgggtccgag atccgccccg aagccgcggg accccgagac       480
     ccttgccccg ggagaggccc aggcgccttt acccggtttc attttcagtt taggccaaaa       540
     atccccccag gttggtcggg gcggggcggg gctcggggga ccgggctgac cgcggggtcc       600
     gggccaggtt ctcacaccgt ccagaggatg tatggctgcg acgtggggtc ggactggcgc       660
     ttcctccgcg ggtaccacca gtacgcctac gacggcaagg attacatcgc cctgaaagag       720
     gacctgcgct cttggaccgc ggcggacatg gcagctcaga ccaccaagca caagtgggag       780
     gcggcccatg tggcggagca gttgagagcc tacctggagg gcacgtgcgt ggagtggctc       840
     cgcagatacc tggagaacgg gaaggagacg ctgcagtgca cgggtaccag gggccacggg       900
     gcgcctccct gatcgcctgt agatctcccg ggctggcctc ccacaaggag gggagacaat       960
     tgggaccaac actagaatat cgccctccct ctggtcctga gggagaggaa tcctcctggg      1020
     tttccagatc ctgtaccaga gagtgactct gaggttccgc cctgctctct gacacaatta      1080
     agggataaaa tctctgaagg aatgacggga agacgatccc tcgaatactg atgagtggtt      1140
     ccctttgaca cacacaggca gcagcc                                           1166
//


spacer
spacer