Dbfetch

ID   FJ810056; SV 1; linear; genomic DNA; STD; HUM; 1090 BP.
XX
AC   FJ810056;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*66 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1090
RA   Qiu Q., He J., Yan X., Bao X., Yao L., Cen J., Chen Z.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   HLA High Typing Laboratory, The First Affiliated Hospital of Soochow
RL   University, Jiangsu Institute of Hematology, 188 Shizi Street, Suzhou,
RL   Jiangsu 215006, P.R.China
XX
DR   MD5; 1cd235ffc0fe90ba8f4cec7a8b960d1b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1090
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1090
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 variant"
FT   mRNA            join(<37..306,548..>823)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<37..306,548..>823)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*66:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C1KBJ3"
FT                   /protein_id="ACO40325.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            37..306
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 variant"
FT                   /number=2
FT   exon            548..823
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 variant"
FT                   /number=3
XX
SQ   Sequence 1090 BP; 208 A; 343 C; 371 G; 168 T; 0 other;
     agggtcgggc gggtctcagc cactcctcgc ccccaggctc ccactccatg aggtatttct        60
     acacctccgt gtcccggccc ggccgcgggg agccccgctt catcgccgtg ggctacgtgg       120
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaggatg gagccgcggg       180
     cgccgtggat agagcaggag gggccggagt attgggaccg gaacacacgg aatgtgaagg       240
     cccagtcaca gactgaccga gtggacctgg ggaccctgcg cggctactac aaccagagcg       300
     aggacggtga gtgaccccgg cccggggcgc aggtcacgac ccctcatccc ccacggacgg       360
     gccaggtcgc ccacagtctc cgggtccgag atccgccccg aagccgcggg accccgagac       420
     ccttgccccg ggagaggccc aggcgccttt acccggtttc attttcagtt taggccaaaa       480
     atccccccgg gttggtcggg gcggggcggg gctcggggga ccgggctgac ctcggggtcc       540
     gggccaggtt ctcacaccat ccagaggatg tatggctgcg acgtggggcc ggacgggcgc       600
     ttcctccgcg ggtaccagca ggacgcttac gacggcaagg attacatcgc cctgaacgag       660
     gacctgcgct cttggaccgc ggcggacatg gcggctcaga tcacccagcg caagtgggag       720
     acggcccatg aggcggagca gtggagagcc tacctggagg gccggtgcgt ggacgggctc       780
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgca cgggtaccag gggccacggg       840
     gcgcctccct gatcgcctgt agatctcccg ggctggcctc ccacaaggag gggagacaat       900
     tgggaccaac actagaatat cgccctccct ctggtcctga gggagaggaa tcctcctggg       960
     tttccagatc ctgtaccaga gagtgactct gaggttccgc cctgctctct gacacaatta      1020
     agggataaaa tctctgaagg aatgacggga agacgatccc tcgaatactg atgagtggtt      1080
     ccctttgaca                                                             1090
//