spacer

EBI Dbfetch

ID   FJ797358; SV 1; linear; genomic DNA; STD; HUM; 1853 BP.
XX
AC   FJ797358;
XX
DT   25-MAR-2009 (Rel. 100, Created)
DT   25-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens isolate BY00444 MHC class I antigen (HLA-Cw) gene,
DE   HLA-Cw-Cw*03 variant allele, exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1853
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class I Alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1853
RA   Lazaro A.M., Xiao Y., Masaberg C., Hurley C.K.;
RT   ;
RL   Submitted (25-FEB-2009) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd., N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 332aaca3d7669fa2a355635c09dd4f14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1853
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00444"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1853
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT   mRNA            join(<1..73,204..473,720..995,1578..>1853)
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,720..995,1578..>1853)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C0M115"
FT                   /db_xref="IMGT/HLA:C*03:58"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C0M115"
FT                   /protein_id="ACN89845.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEARSHTLQWMCGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /number=1
FT   gap             74..203
FT                   /estimated_length=130
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /number=2
FT   gap             474..719
FT                   /estimated_length=246
FT   exon            720..995
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /number=3
FT   gap             996..1577
FT                   /estimated_length=582
FT   exon            1578..>1853
FT                   /gene="HLA-Cw"
FT                   /allele="Cw*03 variant"
FT                   /number=4
XX
SQ   Sequence 1853 BP; 179 A; 281 C; 310 G; 125 T; 958 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccannnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng       720
     gtctcacacc ctccagtgga tgtgtggctg cgacctgggg cccgacgggc gcctcctccg       780
     cgggtataac cagttcgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       840
     ctcctggacc gccgcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgaggcggag cagcggagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcggnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnaac acccaaagac acacgtgacc caccatcccg tctctgacca      1620
     tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg      1680
     gcagtgggat ggggaggacc aaactcagga caccgagctt gtggagacca ggccagcagg      1740
     agatggaacc ttccagaagt gggcagctgt gatggtgcct tctggagaag agcagagata      1800
     cacgtgccat gtgcagcacg aggggctgcc ggagcccctc accctgagat ggg             1853
//


spacer
spacer