spacer

EBI Dbfetch

ID   FJ765571; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   FJ765571;
XX
DT   26-FEB-2010 (Rel. 103, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Homo sapiens clone B_359_01091 MHC class I antigen (HLA-B) gene, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by Histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (18-FEB-2009) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; 76dc99862e3aaf0c83238ff94634562d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="B_359_01091"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3U3N1"
FT                   /db_xref="IMGT/HLA:B*07:102"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3U3N1"
FT                   /protein_id="ACN76611.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEDGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 788 BP; 112 A; 171 C; 194 G; 69 T; 242 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac accctccaga gcatgtacgg       540
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat gaccagtacg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gcgctcctgg accgccgcgg acacggcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg gagcagcgga gagcctacct       720
     ggagggcgag tgcgtggagt ggctccgcag atacctggag aacgggaagg acaagctgga       780
     gcgcgctg                                                                788
//


spacer
spacer